Mudaakhilat - مداخلت meanings in English

Mudaakhilat - مداخلت meanings in English are intromittent, interdigitation, intercoming, intercentrum, meddles, meddled, intrusts, intrusted, intrusions, interveins, interduce, interferingly, interfretted, intreatance, interwreathe, intervent, intervenient, interveniency, intervenience, intermination, intermigration, intermention, intervein, interties, interring, intrusion, intervention, interference, intercurrence, interception, incursion, admission, access, pragmatism, invasion, interbred, interbreed, interposed, interments, interfuses, interfused, interferes, intrust, interreflection, interfering, interbreeding, encroachment Mudaakhilat - مداخلت in English. More meanings of mudaakhilat - مداخلت, it's definitions, example sentences, related words, idioms and quotations.

intromittent interdigitation intercoming intercentrum meddles meddled intrusts intrusted intrusions interveins interduce interferingly interfretted intreatance interwreathe intervent intervenient interveniency intervenience intermination intermigration intermention intervein interties interring intrusion intervention interference intercurrence interception incursion admission access pragmatism invasion interbred interbreed interposed interments interfuses interfused interferes intrust interreflection interfering interbreeding encroachment

Install chrome extension

Mudaakhilat - مداخلت Definitions

Please find 46 English and definitions related to the word Mudaakhilat - مداخلت.

  • (noun) : the act of approaching or entering
  • (noun) : a way of entering or leaving
  • (noun) : (computer science) the operation of reading or writing stored information
  • (noun) : the right to obtain or make use of or take advantage of something (as services or membership)
  • (noun) : the right to enter
  • (verb) : obtain or retrieve from a storage device; as of information on a computer
  • (verb) : reach or gain access to
  • (noun) : a code (a series of characters or digits) that must be entered in some way (typed or dialed or spoken) to get the use of something (a telephone line or a computer or a local area network etc.)
  • (noun) : influencing strongly
  • (noun) : entry to another's property without right or permission
  • (noun) : any entry into an area not previously occupied
  • (noun) : (philosophy) the doctrine that practical consequences are the criteria of knowledge and meaning and value
  • (noun) : the attribute of accepting the facts of life and favoring practicality and literal truth
  • (noun) : the right to enter
  • (noun) : the act of admitting someone to enter
  • (noun) : an acknowledgment of the truth of something
  • (noun) : the fee charged for admission
  • (noun) : the act of entering some territory or domain (often in large numbers)
  • (noun) : the mistake of incurring liability or blame
  • (noun) : an attack that penetrates into enemy territory
  • (adjective satellite) : bred of closely related parents
  • (verb) : breed animals or plants using parents of different races and varieties
  • (noun) : (genetics) the act of mixing different species or varieties of animals or plants and thus to produce hybrids
  • (noun) : reproduction by parents of different races (especially by white and non-white persons)
  • (noun) : (American football) the act of catching a football by a player on the opposing team
  • (noun) : the act of intercepting; preventing something from proceeding or arriving
  • (noun) : electrical or acoustic activity that can disturb communication
  • (noun) : the act of hindering or obstructing or impeding
  • (noun) : (American football) blocking a player's path with your body
  • (noun) : a policy of intervening in the affairs of other countries
  • (adjective satellite) : intrusive in a meddling or offensive manner
  • (noun) : reciprocal reflection between two reflecting surfaces
  • (noun) : a policy of intervening in the affairs of other countries
  • (noun) : the act or fact of interposing one thing between or among others
  • (noun) : care provided to improve a situation (especially medical procedures or applications that are intended to relieve illness or injury)
  • (noun) : the act of intervening (as to mediate a dispute, etc.)
  • (noun) : (law) a proceeding that permits a person to enter into a lawsuit already in progress; admission of person not an original party to the suit so that person can protect some right or interest that is allegedly affected by the proceedings
  • (noun) : entry to another's property without right or permission
  • (noun) : any entry into an area not previously occupied
  • (noun) : entrance by force or without permission or welcome
  • (noun) : rock produced by an intrusive process
  • (noun) : the forcing of molten rock into fissures or between strata of an earlier rock formation
  • (verb) : confer a trust upon
  • (noun) : any entry into an area not previously occupied
  • (noun) : (pathology) the spread of pathogenic microorganisms or malignant cells to new sites in the body
  • (noun) : the act of invading; the act of an army that invades for conquest or plunder

More words related to the meanings of Mudaakhilat - مداخلت

Accessباٹ baat باٹ Baatt راہ raah راہ Rah رستہ rastah رستہ Rasta آر جار گزر guzar گزر Guzer آنا جانا aana jaana آمد و رفت aamad o raft دسترس dastaras پہنچ pahonch پہنچ Pohanch مداخلت mudaakhilat مداخلت Mudaakhlat گزارہ guzaarah گزارہ Guzara دخل dakhl دخل Dakhal رسائ rasaa i رسائ risaa i رسائ Rasaee رسوخ rusuukh رسوخ Rasookh
Encroachmentقبضہ qabzah قبضہ Qabza تجاوز tajaawuz تجاوز Tajawuz تجاوُز مداخلت mudaakhilat مداخلت Mudaakhlat بے جا مداخلت bey ja mudaakhilat دست اندازی dast andaazi
Pragmatismمداخلت mudaakhilat مداخلت Mudaakhlat دخل در معقولات کرنا فضول خدمتی
Admissionتسلیم tasliim تسلیم Tasleem گزر guzar گزر Guzer اقرار eqraar اقرار Iqraar پہنچ pahonch پہنچ Pohanch داخلہ daakhilah داخلہ Daakhla مداخلت mudaakhilat مداخلت Mudaakhlat رسائ rasaa i رسائ risaa i رسائ Rasaee بار یابی baar yaabi اقبال جرم eqbaal e jurm
Incursionحملہ hamlah حملہ Hamla مداخلت mudaakhilat مداخلت Mudaakhlat چھاپا chhaapa چھاپا Chapaa چڑھائ charhaa i دھاوا dhaawa دھاوا dhaawaa دھاوا Dhawa
Interbredمداخلت mudaakhilat مداخلت Mudaakhlat
Interbreedمداخلت mudaakhilat مداخلت Mudaakhlat
Interbreedingمداخلت mudaakhilat مداخلت Mudaakhlat
Interceptionمزاحمت muzaahimat اٹکاؤ atakaa o اٹکاؤ atkaa o مداخلت mudaakhilat مداخلت Mudaakhlat دخل اندازی dakhl andaazi
Interferenceرکاوٹ rukaawat رکاوٹ Rukawat روک rok روک Roak ہاتھ haath ہاتھ Hath مداخلت mudaakhilat مداخلت Mudaakhlat دخل اندازی dakhl andaazi
Interferingمداخلت mudaakhilat مداخلت Mudaakhlat
Interreflectionمداخلت mudaakhilat مداخلت Mudaakhlat
Interventionوسیلہ wasiilah وسیلہ Waseela آڑ aar آڑ Aard مداخلت mudaakhilat مداخلت Mudaakhlat توسط tawassut بیچ بچاؤ biich bachaa o
Intrusionمداخلت mudaakhilat مداخلت Mudaakhlat دخل dakhl دخل Dakhal دست اندازی dast andaazi
Intrustمداخلت mudaakhilat مداخلت Mudaakhlat
Invasionحملہ hamlah حملہ Hamla مداخلت mudaakhilat مداخلت Mudaakhlat یورش yuurish غلبہ ghalbah غلبہ Ghalba چڑھائ charhaa i حربہ harbah یلغار yal ghaar یلغار yalghaar
Interferesمداخلت mudaakhilat مداخلت Mudaakhlat
Interfusedمداخلت mudaakhilat مداخلت Mudaakhlat
Interfusesمداخلت mudaakhilat مداخلت Mudaakhlat
Intermentsمداخلت mudaakhilat مداخلت Mudaakhlat
Interposedمداخلت mudaakhilat مداخلت Mudaakhlat
Interringمداخلت mudaakhilat مداخلت Mudaakhlat
Intertiesمداخلت mudaakhilat مداخلت Mudaakhlat
Interveinمداخلت mudaakhilat مداخلت Mudaakhlat
Interveinsمداخلت mudaakhilat مداخلت Mudaakhlat
Intrusionsمداخلت mudaakhilat مداخلت Mudaakhlat
Intrustedمداخلت mudaakhilat مداخلت Mudaakhlat
Intrustsمداخلت mudaakhilat مداخلت Mudaakhlat
Meddledمداخلت mudaakhilat مداخلت Mudaakhlat
Meddlesمداخلت mudaakhilat مداخلت Mudaakhlat
Intercentrumمداخلت mudaakhilat مداخلت Mudaakhlat
Intercomingمداخلت mudaakhilat مداخلت Mudaakhlat
Intercurrenceمداخلت mudaakhilat مداخلت Mudaakhlat
Interdigitationمداخلت mudaakhilat مداخلت Mudaakhlat
Interduceمداخلت mudaakhilat مداخلت Mudaakhlat
Interferinglyمداخلت mudaakhilat مداخلت Mudaakhlat
Interfrettedمداخلت mudaakhilat مداخلت Mudaakhlat
Intermentionمداخلت mudaakhilat مداخلت Mudaakhlat
Intermigrationمداخلت mudaakhilat مداخلت Mudaakhlat
Interminationمداخلت mudaakhilat مداخلت Mudaakhlat
Intervenienceمداخلت mudaakhilat مداخلت Mudaakhlat
Interveniencyمداخلت mudaakhilat مداخلت Mudaakhlat
Intervenientمداخلت mudaakhilat مداخلت Mudaakhlat
Interventمداخلت mudaakhilat مداخلت Mudaakhlat
Interwreatheمداخلت mudaakhilat مداخلت Mudaakhlat
Intreatanceمداخلت mudaakhilat مداخلت Mudaakhlat
Intromittentمداخلت mudaakhilat مداخلت Mudaakhlat

More words from English related to Mudaakhilat - مداخلت

View an extensive list of words below that are related to the meanings of the word Mudaakhilat - مداخلت meanings in English in English.

acceptanceapprobationhomageadmissionadmitteddeferencegreetingshonouringrenditionresignationsalutationsubmissionsurrendersubulateversifiesadmitaccessmarketroutewaitpathwayweightgangwaygatetrackventwaycoursecustomheadwayjourneymethodpathprogressroadroadmapwentgutavenuecarrotentranceegresspassagepassingtravelcontactcommunicationmovementtransportationacknowledgement ...

Idiom related to the meaning of Mudaakhilat - مداخلت

What are the meanings of Mudaakhilat - مداخلت in English?

Meanings of the word Mudaakhilat - مداخلت in English are access, encroachment, pragmatism, admission, incursion, interbred, interbreed, interbreeding, interception, interference, interfering, interreflection, intervention, intrusion, intrust, invasion, interferes, interfused, interfuses, interments, interposed, interring, interties, intervein, interveins, intrusions, intrusted, intrusts, meddled, meddles, intercentrum, intercoming, intercurrence, interdigitation, interduce, interferingly, interfretted, intermention, intermigration, intermination, intervenience, interveniency, intervenient, intervent, interwreathe, intreatance and intromittent. To understand how would you translate the word Mudaakhilat - مداخلت in English, you can take help from words closely related to Mudaakhilat - مداخلت or it’s English translations. Some of these words can also be considered Mudaakhilat - مداخلت synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Mudaakhilat - مداخلت. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Mudaakhilat - مداخلت in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.

We have tried our level best to provide you as much detail on how to say Mudaakhilat - مداخلت in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Mudaakhilat - مداخلت with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.

Frequently Asked Questions (FAQ)

What do you mean by mudaakhilat?

Meanings of mudaakhilat are access, encroachment, pragmatism, admission, incursion, interbred, interbreed, interbreeding, interception, interference, interfering, interreflection, intervention, intrusion, intrust, invasion, interferes, interfused, interfuses, interments, interposed, interring, interties, intervein, interveins, intrusions, intrusted, intrusts, meddled, meddles, intercentrum, intercoming, intercurrence, interdigitation, interduce, interferingly, interfretted, intermention, intermigration, intermination, intervenience, interveniency, intervenient, intervent, interwreathe, intreatance and intromittent

Whats the definition of mudaakhilat?

Definition of the mudaakhilat are

  • the act of approaching or entering
  • a way of entering or leaving
  • (computer science) the operation of reading or writing stored information
  • the right to obtain or make use of or take advantage of something (as services or membership)
  • the right to enter
  • obtain or retrieve from a storage device; as of information on a computer
  • reach or gain access to
  • a code (a series of characters or digits) that must be entered in some way (typed or dialed or spoken) to get the use of something (a telephone line or a computer or a local area network etc.)
  • influencing strongly
  • entry to another's property without right or permission
  • any entry into an area not previously occupied
  • (philosophy) the doctrine that practical consequences are the criteria of knowledge and meaning and value
  • the attribute of accepting the facts of life and favoring practicality and literal truth
  • the right to enter
  • the act of admitting someone to enter
  • an acknowledgment of the truth of something
  • the fee charged for admission
  • the act of entering some territory or domain (often in large numbers)
  • the mistake of incurring liability or blame
  • an attack that penetrates into enemy territory
  • bred of closely related parents
  • breed animals or plants using parents of different races and varieties
  • (genetics) the act of mixing different species or varieties of animals or plants and thus to produce hybrids
  • reproduction by parents of different races (especially by white and non-white persons)
  • (American football) the act of catching a football by a player on the opposing team
  • the act of intercepting; preventing something from proceeding or arriving
  • electrical or acoustic activity that can disturb communication
  • the act of hindering or obstructing or impeding
  • (American football) blocking a player's path with your body
  • a policy of intervening in the affairs of other countries
  • intrusive in a meddling or offensive manner
  • reciprocal reflection between two reflecting surfaces
  • a policy of intervening in the affairs of other countries
  • the act or fact of interposing one thing between or among others
  • care provided to improve a situation (especially medical procedures or applications that are intended to relieve illness or injury)
  • the act of intervening (as to mediate a dispute, etc.)
  • (law) a proceeding that permits a person to enter into a lawsuit already in progress; admission of person not an original party to the suit so that person can protect some right or interest that is allegedly affected by the proceedings
  • entry to another's property without right or permission
  • any entry into an area not previously occupied
  • entrance by force or without permission or welcome
  • rock produced by an intrusive process
  • the forcing of molten rock into fissures or between strata of an earlier rock formation
  • confer a trust upon
  • any entry into an area not previously occupied
  • (pathology) the spread of pathogenic microorganisms or malignant cells to new sites in the body
  • the act of invading; the act of an army that invades for conquest or plunder

What is the synonym of mudaakhilat?

Synonym of word mudaakhilat are باٹ, راہ, رستہ, آر جار, گزر, آنا جانا, آمد و رفت, دسترس, پہنچ, مداخلت

What are the idioms related to mudaakhilat?

Here are the idioms that are related to the word mudaakhilat.

  • Open access