saazish - سازش meanings in English
saazish - سازش meanings in English are confederacy, conspicuity, conspersion, intrigante, intriguer, conspectus, concupiscence, plot, manipulation, intrigue, concord, complot, collusion, cabal, misalliance, machination, conspiracy, conspissation saazish - سازش in English. More meanings of saazish - سازش, it's definitions, example sentences, related words, idioms and quotations.
confederacy conspicuity conspersion intrigante intriguer conspectus concupiscence plot manipulation intrigue concord complot collusion cabal misalliance machination conspiracy conspissation
saazish - سازش Definitions
Please find 39 English and definitions related to the word saazish - سازش.
- (noun) : a clique (often secret) that seeks power usually through intrigue
- (noun) : a plot to carry out some harmful or illegal act (especially a political plot)
- (verb) : engage in plotting or enter into a conspiracy, swear together
- (noun) : the southern states that seceded from the United States in 1861
- (noun) : a secret agreement between two or more people to perform an unlawful act
- (noun) : a group of conspirators banded together to achieve some harmful or illegal purpose
- (noun) : a union of political organizations
- (verb) : go together
- (noun) : the determination of grammatical inflection on the basis of word relations
- (noun) : town in eastern Massachusetts near Boston where the first battle of the American Revolution was fought
- (noun) : capital of the state of New Hampshire; located in south central New Hampshire on the Merrimack river
- (noun) : the first battle of the American Revolution (April 19, 1775)
- (noun) : agreement of opinions
- (noun) : a harmonious state of things in general and of their properties (as of colors and sounds); congruity of parts with one another and with the whole
- (verb) : arrange the words of a text so as to create a concordance
- (verb) : arrange by concord or agreement
- (noun) : a plot to carry out some harmful or illegal act (especially a political plot)
- (noun) : a secret agreement between two or more people to perform an unlawful act
- (noun) : a group of conspirators banded together to achieve some harmful or illegal purpose
- (noun) : a crafty and involved plot to achieve your (usually sinister) ends
- (noun) : exerting shrewd or devious influence especially for one's own advantage
- (noun) : the action of touching with the hands (or the skillful use of the hands) or by the use of mechanical means
- (noun) : an unsuitable alliance (especially with regard to marriage)
- (verb) : engage in plotting or enter into a conspiracy, swear together
- (noun) : a desire for sexual intimacy
- (noun) : an overall summary
- (verb) : form intrigues (for) in an underhand manner
- (verb) : cause to be interested or curious
- (noun) : a crafty and involved plot to achieve your (usually sinister) ends
- (noun) : a clandestine love affair
- (noun) : a person who devises plots or intrigues
- (noun) : a secret scheme to do something (especially something underhand or illegal)
- (noun) : a small area of ground covered by specific vegetation
- (verb) : make a schematic or technical drawing of that shows interactions among variables or how something is constructed
- (noun) : the story that is told in a novel or play or movie etc.
- (verb) : make a plat of
- (noun) : a chart or graph showing the movements or progress of an object
- (verb) : plan secretly, usually something illegal
- (verb) : devise the sequence of events in (a literary work or a play, movie, or ballet)
More words related to the meanings of saazish - سازش
More words from English related to saazish - سازش
View an extensive list of words below that are related to the meanings of the word saazish - سازش meanings in English in English.
accidentagreementco operationconcurrenceconsensusconsentconsonanaceconcordcontingencyfortuitousnessfortuityliaisontemporizeventureaccordancecaduacchancecircumstancecoincidencecommunityhaphaphazardharmonymischanceopportunityunionagreeabilitycoincidingconcretionconcurrencyconsociatecoincidedconcussesconvenancecoincibencycoinheritancecoinitialcoinquinatecoinquinationcointenseactivenessagilityartfulnessfleetnessforwardnessfriskinessmanoeuvrepromptitudequirkinessruse ... slinessalacrityclevernesscraftinessdeftnessfoxinessfraudknacklivelinessmanipulationpertnesstacttactfulnesswilfulnessanimatenesspaltrinesssmarminesstrickinessclerkesscleruchyploidyploverypluviousslickeningsmarteningchalcographyclergialclerklinesscullyismimbecilitateincogitancyincogitativityinvigilancyplatnessaggregate numberconfluencecontiguitycouplingcounterpartjoinderjoiningjointjunctionlimbmachinationmatchpairpatchseamaccountadditionconnectionconnectednesscontenderinosculationjuncturekinshipknuckleknuckle jointlinklinkagemarrowsolderingsumsuturetotalvampaddlesfoldedjoiningsjointsfolded upconfederacycohesionunanimousunityapologuefolklorestorytalelegendmarchennarrativeplotsagayarnanecdoticanecdoticaltaeltalebearinganecdotagestoryingtalegallatalegallastalertalesmentelluralimposturejugglerycircumventiondeceptionguilequackerypearlinessmakepreposterouscreationdeceitinstinctintriguenaturesagacitywisdominherencyinnatenessnaturismnatalitiesnatiformnaturesconnaturalityconnaturalnessnaturalitynaturelessnaturitybroilcorruptiondiscordfracasmischiefruckustainttermagancybrawldissension disturbancehorrorinequityinsurgencykick upmeleemischievousnessoutbreakquarrelrebellionriotseditionstrifeviolencewickednessriotryriotisecaptivatecharmdeludefascinateglamourcabalceremonialcraftgadgetmotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomfashiongaitgimmickryindirectionshenaniganstratagemtactictricktrickerywalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackchousbetrayaldelusiondouble crosswilecoalitionsfriendshipleagueaccordalliancereunificationunanimityalliaceouscoalitionunificationunionisationunioniseunionismunionizationunitisationalliancesunionisesunionisingunionizesunitednessunitionintenerationunitudeunivocacyunivocationpactconformityconformanceconcordancecoordinationmusicconcertconsonanceco ordinationkeepingassimilatoryco ordinatecoherencycohesivenesscomatosenesscompanionabilitycompanionablenesscompliancyconcomitanceconformismcongenialitycontemporaneitycontemporaneousnesscoordinatingcovalencecovalencycovariancecurlinessharmonicharmonicalharmonicsharmoniousnessharmonisationharmonisedharmonizationharmonizeharmonizedintegumentintemperatenessneighborlinessneighbourlinesssymmetrisesymphonisesynchroneitysynchronicitysynchronismsynclinalsyncopationsyncopesyncreticsyncreticalsyncretisesyncretismsyncretisticsynergeticsynergismsynonymysynsemantictongsunneighborlinessasswagingcoeternalcogencecoherencescoheringcohesionscohobatingcohyponymcoignedcompearantconcordialharmoniesharmonisesharmonizessyncarpysynchsynchssynchysissynclinalssynclinesynclinessyncopicsyncssyndingsynecticssynergicsynergisedsynergisessynergizedsynergizessyngamoussyngamysyngeneticsynonymiesamabilitycoadjustmentcoadventurecobelligerentcoessentialitycoeternitycoevouscohesibilitycompurgatorialconcomitancyconcordableconcordancyconcorporateconcorporationconcurrentnessconducivenessconsortshipcontemporarinesscontorniatecoordinatenesscordialnessincongruenceincoordinateintegumationintegumentationomniformitysamelinesssompnoursymmetrizedsynchronicalsynchronisticsynchronologysynclinicalsyncopatingsyncrisissynonymalconspiremachinatecolludeframe upconspiringplotteringplottingconspiracycollusionnexusesrheumierconcoctersconcoctorsfeint humbughypocrisyshamhoaxinsincerityquizfictionforeclosureligationphraseologybondcompositionconstraintlimitationobstructionphraselogyplanqualmrestrictionclosuredebarmentclosingsclosuresdebarmentsdebarringoutagescloshincloisteroffuscationfishing netmoneynettrapbaitbidcostdecoylatchloanpricesnaretrepanvaluegrudgehostilitytaxaffectionaffinityanimosityantagonismattachmentcorrelationill feelingloverelationrelevancyloggeobviationwheyantidotebrachiationbreak evensmash upparbreakparbreakedparbreakssmashesmacrocosmallitrationepigramingenuityquibblequirkskilluniversaluniversewitworldfibberymakingmanufacturemasturbationself pollutionmanipulatejockeyhandiworkhandworkmanualcontrivancedevicemanipulablemaniplesmanipularmanipulatedmanipulatingmanipulatorymisallianceoverturetabulatesginprojectproposalrecommendationschemesuggestionpropositussuggestibilitydiscommendpreposedpropensionpropinespropiningproposestipsifyingdiscommendationpresupposalpropicepropinationsuggestmentprogramconcotiondemarcheprogrammeterrainaffiliationcollaborationconsortiumcontributioncorporationparticipationpartnershipattendbackbitingcunningnessslynessbandbatchcliquegroupteamtroopintegrationone dimensionalitysingle mindedlysingle mindednessunidimensionalpersecutionslandermasterytricking
Idioms related to the meaning of saazish - سازش
What are the meanings of saazish - سازش in English?
Meanings of the word saazish - سازش in English are cabal, confederacy, concord, conspiracy, machination, manipulation, misalliance, collusion, complot, concupiscence, conspectus, intrigue, intriguer, plot, intrigante, conspersion, conspicuity and conspissation. To understand how would you translate the word saazish - سازش in English, you can take help from words closely related to saazish - سازش or it’s English translations. Some of these words can also be considered saazish - سازش synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word saazish - سازش. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use saazish - سازش in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say saazish - سازش in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of saazish - سازش with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by سازش?
Meanings of سازش are cabal, confederacy, concord, conspiracy, machination, manipulation, misalliance, collusion, complot, concupiscence, conspectus, intrigue, intriguer, plot, intrigante, conspersion, conspicuity and conspissation
Whats the definition of سازش?
Definition of the سازش are
- a clique (often secret) that seeks power usually through intrigue
- a plot to carry out some harmful or illegal act (especially a political plot)
- engage in plotting or enter into a conspiracy, swear together
- the southern states that seceded from the United States in 1861
- a secret agreement between two or more people to perform an unlawful act
- a group of conspirators banded together to achieve some harmful or illegal purpose
- a union of political organizations
- go together
- the determination of grammatical inflection on the basis of word relations
- town in eastern Massachusetts near Boston where the first battle of the American Revolution was fought
- capital of the state of New Hampshire; located in south central New Hampshire on the Merrimack river
- the first battle of the American Revolution (April 19, 1775)
- agreement of opinions
- a harmonious state of things in general and of their properties (as of colors and sounds); congruity of parts with one another and with the whole
- arrange the words of a text so as to create a concordance
- arrange by concord or agreement
- a plot to carry out some harmful or illegal act (especially a political plot)
- a secret agreement between two or more people to perform an unlawful act
- a group of conspirators banded together to achieve some harmful or illegal purpose
- a crafty and involved plot to achieve your (usually sinister) ends
- exerting shrewd or devious influence especially for one's own advantage
- the action of touching with the hands (or the skillful use of the hands) or by the use of mechanical means
- an unsuitable alliance (especially with regard to marriage)
- engage in plotting or enter into a conspiracy, swear together
- a desire for sexual intimacy
- an overall summary
- form intrigues (for) in an underhand manner
- cause to be interested or curious
- a crafty and involved plot to achieve your (usually sinister) ends
- a clandestine love affair
- a person who devises plots or intrigues
- a secret scheme to do something (especially something underhand or illegal)
- a small area of ground covered by specific vegetation
- make a schematic or technical drawing of that shows interactions among variables or how something is constructed
- the story that is told in a novel or play or movie etc.
- make a plat of
- a chart or graph showing the movements or progress of an object
- plan secretly, usually something illegal
- devise the sequence of events in (a literary work or a play, movie, or ballet)
What is the synonym of سازش?
Synonym of word سازش are خُفِيَہ تَنظيم, سازَشی گِروہ, جتھہ, سازش, سازشی گروہ, سانٹھ گانٹھ, اتحاد, عہد و پیمان, قول و قرار, ایکا
What are the idioms related to سازش?
Here are the idioms that are related to the word سازش.
- Plot proof
- Concord makes lowly power helpful
- Strength is increased by concord