Baehna - بہنا meanings in English

Baehna - بہنا meanings in English are drift, runny, run, dribble, waft, jet, glide, flush, flow, flows Baehna - بہنا in English. More meanings of baehna - بہنا, it's definitions, example sentences, related words, idioms and quotations.

drift runny run dribble waft jet glide flush flow flows

Install chrome extension

Baehna - بہنا Definitions

Please find 112 English and 2 Urdu definitions related to the word Baehna - بہنا.

  • (noun) : the propulsion of a ball by repeated taps or kicks
  • (noun) : flowing in drops; the formation and falling of drops of liquid
  • (verb) : let or cause to fall in drops
  • (verb) : run or flow slowly, as in drops or in an unsteady stream
  • (verb) : propel
  • (noun) : a horizontal (or nearly horizontal) passageway in a mine
  • (noun) : a general tendency to change (as of opinion)
  • (noun) : a force that moves something along
  • (noun) : the gradual departure from an intended course due to external influences (as a ship or plane)
  • (noun) : a process of linguistic change over a period of time
  • (verb) : vary or move from a fixed point or course
  • (verb) : be piled up in banks or heaps by the force of wind or a current
  • (verb) : be subject to fluctuation
  • (verb) : drive slowly and far afield for grazing
  • (verb) : cause to be carried by a current
  • (verb) : move in an unhurried fashion
  • (verb) : live unhurriedly, irresponsibly, or freely
  • (verb) : wander from a direct course or at random
  • (noun) : the pervading meaning or tenor
  • (noun) : a large mass of material that is heaped up by the wind or by water currents
  • (verb) : move along, of liquids
  • (noun) : dominant course (suggestive of running water) of successive events or ideas
  • (verb) : cause to flow
  • (verb) : fall or flow in a certain way
  • (noun) : the act of flowing or streaming; continuous progression
  • (noun) : the motion characteristic of fluids (liquids or gases)
  • (noun) : any uninterrupted stream or discharge
  • (noun) : the amount of fluid that flows in a given time
  • (noun) : something that resembles a flowing stream in moving continuously
  • (noun) : the monthly discharge of blood from the uterus of nonpregnant women from puberty to menopause
  • (verb) : move or progress freely as if in a stream
  • (verb) : cover or swamp with water
  • (verb) : be abundantly present
  • (verb) : undergo menstruation
  • (adjective satellite) : having an abundant supply of money or possessions of value
  • (noun) : the period of greatest prosperity or productivity
  • (noun) : sudden reddening of the face (as from embarrassment or guilt or shame or modesty)
  • (verb) : turn red, as if in embarrassment or shame
  • (noun) : a poker hand with all 5 cards in the same suit
  • (noun) : sudden brief sensation of heat (associated with menopause and some mental disorders)
  • (verb) : cause to flow or flood with or as if with water
  • (verb) : flow freely
  • (verb) : rinse, clean, or empty with a liquid
  • (verb) : irrigate with water from a sluice
  • (adverb) : squarely or solidly
  • (adverb) : in the same plane
  • (verb) : glow or cause to glow with warm color or light
  • (adjective satellite) : of a surface exactly even with an adjoining one, forming the same plane
  • (noun) : a vowellike sound that serves as a consonant
  • (noun) : an artificially produced flow of water
  • (noun) : street names for ketamine
  • (verb) : issue in a jet; come out in a jet; stream or spring forth
  • (noun) : an airplane powered by one or more jet engines
  • (verb) : fly a jet plane
  • (adjective satellite) : of the blackest black; similar to the color of jet or coal
  • (noun) : atmospheric discharges (lasting 10 msec) bursting from the tops of giant storm clouds in blue cones that widen as they flash upward
  • (noun) : a hard black form of lignite that takes a brilliant polish and is used in jewelry or ornamentation
  • (verb) : be diffused
  • (verb) : flee; take to one's heels; cut and run
  • (verb) : include as the content; broadcast or publicize
  • (noun) : a race between candidates for elective office
  • (verb) : run, stand, or compete for an office or a position
  • (verb) : keep company
  • (verb) : move along, of liquids
  • (verb) : continue to exist
  • (verb) : perform as expected when applied
  • (verb) : pursue for food or sport (as of wild animals)
  • (verb) : cause something to pass or lead somewhere
  • (verb) : stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
  • (verb) : have a tendency or disposition to do or be something; be inclined
  • (verb) : progress by being changed
  • (verb) : direct or control; projects, businesses, etc.
  • (verb) : compete in a race
  • (noun) : a row of unravelled stitches
  • (verb) : change or be different within limits
  • (noun) : a small stream
  • (noun) : a score in baseball made by a runner touching all four bases safely
  • (noun) : the act of running; traveling on foot at a fast pace
  • (noun) : a regular trip
  • (noun) : a short trip
  • (noun) : an unbroken chronological sequence
  • (noun) : the production achieved during a continuous period of operation (of a machine or factory etc.)
  • (noun) : unrestricted freedom to use
  • (noun) : the continuous period of time during which something (a machine or a factory) operates or continues in operation
  • (noun) : an unbroken series of events
  • (noun) : the act of testing something
  • (noun) : a race run on foot
  • (verb) : cause an animal to move fast
  • (verb) : move about freely and without restraint, or act as if running around in an uncontrolled way
  • (verb) : deal in illegally, such as arms or liquor
  • (verb) : set animals loose to graze
  • (verb) : make without a miss
  • (verb) : carry out a process or program, as on a computer or a machine
  • (verb) : occur persistently
  • (verb) : extend or continue for a certain period of time
  • (verb) : be affected by; be subjected to
  • (verb) : have a particular form
  • (verb) : become undone
  • (verb) : cause to perform
  • (verb) : change from one state to another
  • (verb) : be operating, running or functioning
  • (verb) : carry out
  • (verb) : cover by running; run a certain distance
  • (verb) : move fast by using one's feet, with one foot off the ground at any given time
  • (verb) : travel rapidly, by any (unspecified) means
  • (verb) : run with the ball; in such sports as football
  • (verb) : sail before the wind
  • (verb) : come unraveled or undone as if by snagging
  • (verb) : reduce or cause to be reduced from a solid to a liquid state, usually by heating
  • (noun) : (American football) a play in which a player attempts to carry the ball through or past the opposing team
  • (verb) : cause to emit recorded audio or video
  • (verb) : pass over, across, or through
  • جہاز کا سیدھے راستے سے اِنحراف
  • بڑی مقدار میں یکبارگی تیزی سے پانی بہا کر نالی یا بدر رو صاف کرنا

More words related to the meanings of Baehna - بہنا

Dribbleبانٹنا baantna بانٹنا Baantina ٹپکانا tapkaana ٹپکنا tapakna چونا chuuna چونا Choona تللی بندھنا بہنا baehna بہنا Behna قطرہ قطرہ ٹپکنا qatrah qatrah tapakna
Driftڈھیر dheyr ڈھیر Dhair تودہ Todah بہاؤ bahaa o بہاؤ Bahao سیل sael سیل siil سیل Sell جھال Jhaal دھارا dhaara بہا کر ڈھیر کردینا اڑا کر جمع کر دینا بہا لانا اڑا لانا بہنا baehna بہنا Behna بہاوٴ Bahao رو ru رو rau رو Ro مراد muraad
Flowپرواہ parwaah پرواہ par waah بہاؤ bahaa o بہاؤ Bahao دھار dhaar دھارا dhaara بہنا baehna بہنا Behna روانی rawaani ادرار Adraar ڈھلکنا dhalakna جاری ہونا jaari hona رواں ہونا
Flushکثرت kasrat پھیلنا phaelna پھیلنا Phelna جوش josh بہنا baehna بہنا Behna ابال ubaal دمک damak نیا naya طغیانی tughiyaani طغیانی tughyaani طغیانی Tugyani بہہ نکلنا تازہ taazah تازہ Taaza تر و تازہ چمکتا chamakta دمکتا damakta تہ درد لال یا سرخ کر دینا
Glideبہاؤ bahaa o بہاؤ Bahao بہنا baehna بہنا Behna جانا jaana جانا Jana گزرنا guzarna پھسلنا phisalna سبکی سے چلنا آسانی سے حرکت کرنا ہلکی اور تیز چال پھسلن phislan گزار guzaar بلا دم لگائے اڑنا bila dam lagaa ey urna
Jetاکڑنا akarna بہنا baehna بہنا Behna نل nal نل Null سنگ موسی سیاہ تاب دھار نکلنا یا پڑنا فوارہ fauwaarah فوارہ Fawwara ٹونٹی tonti اینٹھ کر چلنا aenth kar chalna دھار نکلنا dhaar nikalna فوارہ چھوٹنا fauwaarah chhuutna تیز دھار نکلنا teyz dhaar nikalna نوک دار نلی nok daar nali پانی وغیرہ کی تیز دھار paani waghaerah ki teyz dhaar
Runچلانا chillaana چلانا chalaana چلانا Chalana دوڑنا daurna دوڑنا Dorna بہنا baehna بہنا Behna بھاگنا bhaagna بھاگنا Bhegana چلنا chalna تيز تيز چَلنا لپکنا lapakna لپکانا lapkaana رَن رپٹنا rapatna بھگانا bhagaana بھگانا bhigaana دوڑانا dauraana رپٹانا raptaana
Waftاڑا لے جانا ura ley jaana اڑا لے جانا uraa ley jaana ہلکورا hilkora ہلکورا halkora لہر laehr لہر laher لہر Lehar جھوکا Jhoka لے جانا ley jaana ترسیل کرنا tarsiil karna جنبش junbish بہنا baehna بہنا Behna اڑنا urna اڑنا arna اڑنا Urdna بہا لے جانا ہلکور Halkour جھولا jhola جھولا jhuula جھولا Jhoola تیرنا taerna تیرا لے جانا جھکولا jhakola خوشی کی لہر جھونکا jhonka ہلکے سے بہا لے جانا halkey sey baha ley jaana سانس یا ہوا کا جھونکا saans ya hawa ka jhonka
Runnyبہنا baehna بہنا Behna
Flowsبہنا baehna بہنا Behna

More words from English related to Baehna - بہنا

View an extensive list of words below that are related to the meanings of the word Baehna - بہنا meanings in English in English.

abductwaftkidnapmoochabluvionflowanxietycareconcerndesireheedcaressedabundanceflushfrequencyglutmuchmultiplicitynumerousnessopulenceoverstockpluralityprofusenessrampancyrichnessvastnessaffluencebulkexcessexuberanceinfestationinfluxlargenesslavishmuchnessmultitudenimietynumerosityoutpouringplentypleromaplethoraoftennesspolyvalenceaboundsabundancesabundancyfrequentagefrequentationmulierosity ...

Idioms related to the meaning of Baehna - بہنا

Englishاردو
Practise thrift or etse you'll driftجو کفایت شُعاری نہیں برتتا تباہ ہو جاتا ہے
A flow will have an ebbہر کمال کا زوال ہوتا ہے
Deep rivers flow in silenceدھیرا سو گھمبیرا
Flow with milk and honeyخوشالی سے مزین
A thousand years hence the river will run as it didیہ چمن یوں ہی رہے گا دنیا کا سدا یہی حال رہے گا
Do not run up against hungry manبھوکا شیر خطرناک ہوتا ہے
If you run after two hares you will catch neitherدھوبی کا کتا نہ گھر کا نہ گھاٹ کا
In the long runآخر کار
In the long runسخت کوشش کے بعد
Need makes the naked man runمرتا کیا نہ کرتا
On the runدربدر پھرنا
Run acrossاچانک ملنا
Run downتعاقب سے تھکادینا
Run errandجھوٹے موٹے کام کرنا
Run hardمشکل ہونا
Run inگرفتار ہو کر جیل جانا
Run in the blood familyورثہ میں ہونا
Run into debtقرضہ میں جکڑنا
Run it fineمناسب گنجائش دینا
Run offدہرانا یا چھاپنا
View More ...

What are the meanings of Baehna - بہنا in English?

Meanings of the word Baehna - بہنا in English are dribble, drift, flow, flush, glide, jet, run, waft, runny and flows. To understand how would you translate the word Baehna - بہنا in English, you can take help from words closely related to Baehna - بہنا or it’s English translations. Some of these words can also be considered Baehna - بہنا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Baehna - بہنا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Baehna - بہنا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.

We have tried our level best to provide you as much detail on how to say Baehna - بہنا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Baehna - بہنا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.

Frequently Asked Questions (FAQ)

What do you mean by baehna?

Meanings of baehna are dribble, drift, flow, flush, glide, jet, run, waft, runny and flows

Whats the definition of baehna?

Definition of the baehna are

  • the propulsion of a ball by repeated taps or kicks
  • flowing in drops; the formation and falling of drops of liquid
  • let or cause to fall in drops
  • run or flow slowly, as in drops or in an unsteady stream
  • propel
  • a horizontal (or nearly horizontal) passageway in a mine
  • a general tendency to change (as of opinion)
  • a force that moves something along
  • the gradual departure from an intended course due to external influences (as a ship or plane)
  • a process of linguistic change over a period of time
  • vary or move from a fixed point or course
  • be piled up in banks or heaps by the force of wind or a current
  • be subject to fluctuation
  • drive slowly and far afield for grazing
  • cause to be carried by a current
  • move in an unhurried fashion
  • live unhurriedly, irresponsibly, or freely
  • wander from a direct course or at random
  • the pervading meaning or tenor
  • a large mass of material that is heaped up by the wind or by water currents
  • move along, of liquids
  • dominant course (suggestive of running water) of successive events or ideas
  • cause to flow
  • fall or flow in a certain way
  • the act of flowing or streaming; continuous progression
  • the motion characteristic of fluids (liquids or gases)
  • any uninterrupted stream or discharge
  • the amount of fluid that flows in a given time
  • something that resembles a flowing stream in moving continuously
  • the monthly discharge of blood from the uterus of nonpregnant women from puberty to menopause
  • move or progress freely as if in a stream
  • cover or swamp with water
  • be abundantly present
  • undergo menstruation
  • having an abundant supply of money or possessions of value
  • the period of greatest prosperity or productivity
  • sudden reddening of the face (as from embarrassment or guilt or shame or modesty)
  • turn red, as if in embarrassment or shame
  • a poker hand with all 5 cards in the same suit
  • sudden brief sensation of heat (associated with menopause and some mental disorders)
  • cause to flow or flood with or as if with water
  • flow freely
  • rinse, clean, or empty with a liquid
  • irrigate with water from a sluice
  • squarely or solidly
  • in the same plane
  • glow or cause to glow with warm color or light
  • of a surface exactly even with an adjoining one, forming the same plane
  • a vowellike sound that serves as a consonant
  • an artificially produced flow of water
  • street names for ketamine
  • issue in a jet; come out in a jet; stream or spring forth
  • an airplane powered by one or more jet engines
  • fly a jet plane
  • of the blackest black; similar to the color of jet or coal
  • atmospheric discharges (lasting 10 msec) bursting from the tops of giant storm clouds in blue cones that widen as they flash upward
  • a hard black form of lignite that takes a brilliant polish and is used in jewelry or ornamentation
  • be diffused
  • flee; take to one's heels; cut and run
  • include as the content; broadcast or publicize
  • a race between candidates for elective office
  • run, stand, or compete for an office or a position
  • keep company
  • move along, of liquids
  • continue to exist
  • perform as expected when applied
  • pursue for food or sport (as of wild animals)
  • cause something to pass or lead somewhere
  • stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
  • have a tendency or disposition to do or be something; be inclined
  • progress by being changed
  • direct or control; projects, businesses, etc.
  • compete in a race
  • a row of unravelled stitches
  • change or be different within limits
  • a small stream
  • a score in baseball made by a runner touching all four bases safely
  • the act of running; traveling on foot at a fast pace
  • a regular trip
  • a short trip
  • an unbroken chronological sequence
  • the production achieved during a continuous period of operation (of a machine or factory etc.)
  • unrestricted freedom to use
  • the continuous period of time during which something (a machine or a factory) operates or continues in operation
  • an unbroken series of events
  • the act of testing something
  • a race run on foot
  • cause an animal to move fast
  • move about freely and without restraint, or act as if running around in an uncontrolled way
  • deal in illegally, such as arms or liquor
  • set animals loose to graze
  • make without a miss
  • carry out a process or program, as on a computer or a machine
  • occur persistently
  • extend or continue for a certain period of time
  • be affected by; be subjected to
  • have a particular form
  • become undone
  • cause to perform
  • change from one state to another
  • be operating, running or functioning
  • carry out
  • cover by running; run a certain distance
  • move fast by using one's feet, with one foot off the ground at any given time
  • travel rapidly, by any (unspecified) means
  • run with the ball; in such sports as football
  • sail before the wind
  • come unraveled or undone as if by snagging
  • reduce or cause to be reduced from a solid to a liquid state, usually by heating
  • (American football) a play in which a player attempts to carry the ball through or past the opposing team
  • cause to emit recorded audio or video
  • pass over, across, or through
  • جہاز کا سیدھے راستے سے اِنحراف
  • بڑی مقدار میں یکبارگی تیزی سے پانی بہا کر نالی یا بدر رو صاف کرنا

What is the synonym of baehna?

Synonym of word baehna are بانٹنا, ٹپکانا, ٹپکنا, چونا, تللی بندھنا, بہنا, قطرہ قطرہ ٹپکنا, ڈھیر, تودہ, بہاؤ

What are the idioms related to baehna?

Here are the idioms that are related to the word baehna.

  • Practise thrift or etse you'll drift
  • A flow will have an ebb
  • Deep rivers flow in silence
  • Flow with milk and honey
  • A thousand years hence the river will run as it did

Paragraph Transliteration