mulk - ملک meanings in English
mulk - ملک Definitions
Please find 30 English and 1 Urdu definitions related to the word mulk - ملک.
- (noun) : a particular geographical region of indefinite boundary (usually serving some special purpose or distinguished by its people or culture or geography)
- (noun) : the territory occupied by a nation
- (noun) : an area outside of cities and towns
- (noun) : the people who live in a nation or country
- (noun) : a politically organized body of people under a single government
- (noun) : the people who live in a nation or country
- (noun) : a politically organized body of people under a single government
- (noun) : a federation of tribes (especially native American tribes)
- (noun) : United States prohibitionist who raided saloons and destroyed bottles of liquor with a hatchet (1846-1911)
- (noun) : a region marked off for administrative or other purposes
- (noun) : an area of knowledge or interest
- (noun) : the geographical area under the jurisdiction of a sovereign state
- (noun) : a particular environment or walk of life
- (noun) : people in general; especially a distinctive group of people with some shared interest
- (noun) : territory over which rule or control is exercised
- (noun) : the content of a particular field of knowledge
- (noun) : (mathematics) the set of values of the independent variable for which a function is defined
- (noun) : the domain ruled by a king or queen
- (noun) : a domain in which something is dominant
- (noun) : a knowledge domain that you are interested in or are communicating about
- (noun) : the territory occupied by a nation
- (noun) : a politically organized body of people under a single government
- (verb) : put before
- (noun) : the federal department in the United States that sets and maintains foreign policies
- (noun) : the way something is with respect to its main attributes
- (noun) : the group of people comprising the government of a sovereign state
- (noun) : the territory occupied by one of the constituent administrative districts of a nation
- (noun) : a state of depression or agitation
- (noun) : (chemistry) the three traditional states of matter are solids (fixed shape and volume) and liquids (fixed volume and shaped by the container) and gases (filling the container)
- (verb) : indicate through a symbol, formula, etc.
- راج یا سلطنت کے لوگ یا باشندے
Example Sentence
Labour day celebrated on the first Monday of every September, honors millions of hardworking across the country. | مزدوری کا دن ہر ستمبر کے پہلے پیر کو منایا جاتا ہے ، ملک بھر میں لاکھوں محنت کشوں کو اعزاز دیتا ہے |
More words related to the meanings of mulk - ملک
More words from English related to mulk - ملک
View an extensive list of words below that are related to the meanings of the word mulk - ملک meanings in English in English.
accompanimentconditioneventstanceaccountaffectionmoodnarrativenatureparticularspositionpostureprospectqualityremarkreportsituationstatestatementstoryaffirmaverenunciatelimnnarratedeclaredelineatedemonstratedescribeprefigurereciterecountrehearserelatereputescrivetellescribingnarratingarticulatingdecorticatingdesiccatingelaqueateepitomizingexplicatingagrariancivilcountryhomehomemade ... territorialvernacularindigeneindigenouslocalnativeagresticrusticboorclownhayseedhobkernout backvillageryokelruralistruralisingruralistsruralizesvillagersdehortativeapparitioncontoureffigy emblemfacefigureguiseidealinementlikenessmakemannersemblancesimilitudeappearanceaspectdiagramfeatureformformationgestaltget upimagemakingmodemodelnumeralpatternshapevarietywayshape upamorphismappertainconcerndiocese districtmanorrapportseigniorytenureaffinityareabearingcircleconnectionholdingjurisdictionlocalitynexusprovinceregionrelationrelevancyterritoryzonezonuleparvenueterrineterraneterritterreityterritoriedbuilderjurisprudencekingdomkingshipmasonbricklayerdominiongovernmentrealmreignruleswayrajclimemothermunicipaldomestichome grownhome madehomespunintestinecountryfiedcountryfolkindigenindigenousnessindigeniseambigenousecstasyrapturethisaffaircircumstanceinstantlifepredicamentpresentpresent tensevitalitykeeplikingcasenounplighttrimconfigurationmoraltenorbehaviourcharacterchiccuttingdemeanourfashionfoundinggarbstylevoguemodiusmodussceattempire mastershipministryadministrationauthoritygovernancepowerregimeregimentgovpresidentshipsovereigntystatehoodstatesmanshipimperiumprincipalityemparadisesultanesssultanshipaldermancyaldermanshipempairemprisingemprisonbailiwickdomaineuropeguardianshipwardshipglorymagnificencemajestydignityeleganceeminencegrandeurpompshanshawnseanhousewatchfulabodealcoholcuredruggallowsgibbetremedyillustriousnesspageantrymammonmoneyfortunelucremeansmoolahopulencepelfricheswealthduluthwealthinessrichensrichessedealthpathwayhabitportterrainnationastronomygenrelineamentphysiquejurisdictionaljurisdictivebreedfolkpeopleracetribecircuittractlandterra firmaearthshakingforelandhinterlandcornlandcornlandsforelandslandladieslandwindmainlandermainlandsdegreefitkettledrumopportunitypitchtimeturnwatch
Idioms with the word mulk - ملک in it
Idioms related to the meaning of mulk - ملک
What are the meanings of mulk - ملک in English?
Meanings of the word mulk - ملک in English are country, nation, territory, domain, realm and state. To understand how would you translate the word mulk - ملک in English, you can take help from words closely related to mulk - ملک or it’s English translations. Some of these words can also be considered mulk - ملک synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word mulk - ملک. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use mulk - ملک in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say mulk - ملک in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of mulk - ملک with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by ملک?
Meanings of ملک are country, nation, territory, domain, realm and state
Whats the definition of ملک?
Definition of the ملک are
- a particular geographical region of indefinite boundary (usually serving some special purpose or distinguished by its people or culture or geography)
- the territory occupied by a nation
- an area outside of cities and towns
- the people who live in a nation or country
- a politically organized body of people under a single government
- the people who live in a nation or country
- a politically organized body of people under a single government
- a federation of tribes (especially native American tribes)
- United States prohibitionist who raided saloons and destroyed bottles of liquor with a hatchet (1846-1911)
- a region marked off for administrative or other purposes
- an area of knowledge or interest
- the geographical area under the jurisdiction of a sovereign state
- a particular environment or walk of life
- people in general; especially a distinctive group of people with some shared interest
- territory over which rule or control is exercised
- the content of a particular field of knowledge
- (mathematics) the set of values of the independent variable for which a function is defined
- the domain ruled by a king or queen
- a domain in which something is dominant
- a knowledge domain that you are interested in or are communicating about
- the territory occupied by a nation
- a politically organized body of people under a single government
- put before
- the federal department in the United States that sets and maintains foreign policies
- the way something is with respect to its main attributes
- the group of people comprising the government of a sovereign state
- the territory occupied by one of the constituent administrative districts of a nation
- a state of depression or agitation
- (chemistry) the three traditional states of matter are solids (fixed shape and volume) and liquids (fixed volume and shaped by the container) and gases (filling the container)
- indicate through a symbol, formula, etc.
- راج یا سلطنت کے لوگ یا باشندے
What is the synonym of ملک?
Synonym of word ملک are دیسی, ملکی, دیہاتی, گاؤں کا, دار, دیار, کشور, ملک, سرزمین, بلادی
What are the idioms with the word ملک?
Here are the idioms with the word ملک in them.
- A good tongue is a good weapon
- All the world goes against a person whom fortune betrays
- Dwell under one vine and fig tree
- Dwell under ones vine and fig tree
- Go abroad
What are the idioms related to ملک?
Here are the idioms that are related to the word ملک.
- Father of the nation
- Happy is the nation which has no history
- In a state of nature
- Many laws in a state are a bad sign
- A prophet is not honoured in his own country
How to use ملک in a sentence?
Here are few examples on how to use ملک in a sentence.
- Labour day celebrated on the first Monday of every September, honors millions of hardworking across the country. — مزدوری کا دن ہر ستمبر کے پہلے پیر کو منایا جاتا ہے ، ملک بھر میں لاکھوں محنت کشوں کو اعزاز دیتا ہے