Elaqa - علاقہ meanings in English
Elaqa - علاقہ meanings in English are appertain, province, region, relation, relevancy, state, territory, zone, zonule, parvenue, terrine, terrane, territ, terreity, nexus, locality, jurisdiction, concern, diocese, district, manor, rapport, seigniory, tenure, affinity, area, bearing, circle, connection, holding, territoried Elaqa - علاقہ in English. More meanings of elaqa - علاقہ, it's definitions, example sentences, related words, idioms and quotations.
appertain province region relation relevancy state territory zone zonule parvenue terrine terrane territ terreity nexus locality jurisdiction concern diocese district manor rapport seigniory tenure affinity area bearing circle connection holding territoried
Elaqa - علاقہ Definitions
Please find 84 English and 3 Urdu definitions related to the word Elaqa - علاقہ.
- (noun) : (anthropology) kinship by marriage or adoption; not a blood relationship
- (verb) : be a part or attribute of
- (noun) : a part of a structure having some specific characteristic or function
- (noun) : the extent of a 2-dimensional surface enclosed within a boundary
- (noun) : a part of an animal that has a special function or is supplied by a given artery or nerve
- (noun) : a subject of study
- (noun) : a particular geographical region of indefinite boundary (usually serving some special purpose or distinguished by its people or culture or geography)
- (noun) : a particular environment or walk of life
- (noun) : an unofficial association of people or groups
- (noun) : any circular or rotating mechanism
- (noun) : a curved section or tier of seats in a hall or theater or opera house; usually the first tier above the orchestra
- (noun) : ellipse in which the two axes are of equal length; a plane curve generated by one point moving at a constant distance from a fixed point
- (noun) : something approximating the shape of a circle
- (noun) : movement once around a course
- (noun) : a road junction at which traffic streams circularly around a central island
- (noun) : street names for flunitrazepan
- (verb) : travel around something
- (verb) : form or draw a circle around
- (verb) : move in a circular path above (someone or something)
- (noun) : the territorial jurisdiction of a bishop
- (noun) : a region marked off for administrative or other purposes
- (verb) : regulate housing in; of certain areas of towns
- (noun) : something owned; any tangible or intangible possession that is owned by someone
- (noun) : the act of retaining something
- (noun) : the landed estate of a lord (including the house on it)
- (noun) : the mansion of a lord or wealthy person
- (noun) : the means of connection between things linked in series
- (noun) : a connected series or group
- (noun) : a relationship of mutual understanding or trust and agreement between people
- (noun) : the position and authority of a feudal lord
- (noun) : the estate of a seigneur
- (noun) : the right to hold property; part of an ancient hierarchical system of holding lands
- (noun) : the term during which some position is held
- (verb) : give life-time employment to
- (noun) : a region marked off for administrative or other purposes
- (noun) : an area of knowledge or interest
- (noun) : the geographical area under the jurisdiction of a sovereign state
- (verb) : regulate housing in; of certain areas of towns
- (noun) : (anatomy) any encircling or beltlike structure
- (noun) : an area or region distinguished from adjacent parts by a distinctive feature or characteristic
- (noun) : any of the regions of the surface of the Earth loosely divided according to latitude or longitude
- (verb) : separate or apportion into sections
- (noun) : a locally circumscribed place characterized by some distinctive features
- (noun) : dignified manner or conduct
- (noun) : a rotating support placed between moving parts to allow them to move easily
- (noun) : relevant relation or interconnection
- (adjective) : (of a structural member) withstanding a weight or strain
- (noun) : the act of bringing two things into contact (especially for communication)
- (noun) : the state of being connected
- (noun) : a connecting shape
- (noun) : the process of bringing ideas or events together in memory or imagination
- (noun) : a relation between things or events (as in the case of one causing the other or sharing features with it)
- (noun) : shifting from one form of transportation to another
- (noun) : a supplier (especially of narcotics)
- (noun) : (usually plural) a person who is influential and to whom you are connected in some way (as by family or friendship)
- (noun) : a surrounding or nearby region
- (adjective satellite) : of or characteristic of a parvenu
- (adjective satellite) : characteristic of someone who has risen economically or socially but lacks the social skills appropriate for this new position
- (noun) : the territory occupied by one of the constituent administrative districts of a nation
- (noun) : the proper sphere or extent of your activities
- (noun) : a part of an animal that has a special function or is supplied by a given artery or nerve
- (noun) : the extended spatial location of something
- (noun) : a knowledge domain that you are interested in or are communicating about
- (noun) : a large indefinite location on the surface of the Earth
- (noun) : the approximate amount of something (usually used prepositionally as in in the region of')
- (noun) : an act of narration
- (noun) : an abstraction belonging to or characteristic of two entities or parts together
- (noun) : (usually plural) mutual dealings or connections among persons or groups
- (noun) : (law) the principle that an act done at a later time is deemed by law to have occurred at an earlier time
- (noun) : a person related by blood or marriage
- (noun) : sexual activity between individuals, especially the insertion of a man's penis into a woman's vagina until orgasm and ejaculation occur
- (noun) : the relation of something to the matter at hand
- (noun) : the territory occupied by a nation
- (noun) : a politically organized body of people under a single government
- (verb) : put before
- (noun) : the federal department in the United States that sets and maintains foreign policies
- (noun) : the way something is with respect to its main attributes
- (noun) : the group of people comprising the government of a sovereign state
- (noun) : the territory occupied by one of the constituent administrative districts of a nation
- (noun) : a state of depression or agitation
- (noun) : (chemistry) the three traditional states of matter are solids (fixed shape and volume) and liquids (fixed volume and shaped by the container) and gases (filling the container)
- (verb) : indicate through a symbol, formula, etc.
- (noun) : a pate or fancy meatloaf baked in an earthenware casserole
- (noun) : small beltlike zone
- وہ کیمیائی قُوَّت جو مالی کیول میں ایٹموں کو یکجا رکھتی ہےمشابہت
- کوئی ہَموار زَمين جِس کی حَد بَندی کی گئی ہو
- فيصلَہ صادَر کَرنے کا اِختِيار
More words related to the meanings of Elaqa - علاقہ
More words from English related to Elaqa - علاقہ
View an extensive list of words below that are related to the meanings of the word Elaqa - علاقہ meanings in English in English.
abluvionflowanxietycareconcerndesireheedcaressedaccommodationcapacitylieusitevicinitywhereaboutabouthabitationlocalitylocusnounplaceroomspacevacancyin placerepositionplacetaccompanimentconditioneventstanceaccountaffectionmoodnarrativenatureparticularspositionpostureprospectqualityremarkreportsituationstatestatementstoryaffianceaffiliationengagementimputation ... rapportaffinitybetrothalcomparisoncorrelationproportionratioregardingrelationlinealityappertainco operationkinkindredcontactattachmentconnectionconnectednessconsiderationlinklinkagenexusrelatednessrelativenessconnexionliaisoncollaborationcoalitionscommunionparticipationsubscriptionglamorgravitationhomologyosculationsimilitudeanalogylikenessidenticalnessresemblanceunsimilarityoutmatchedsmatchedsmatchesassimilabilitydisassimilationsimilarykinsmanshipdividendfellowship friendshipnumeratoranasconcatenationconcordancebondcoherencecohesionconsistencycontiguityconningslinkagesconsanguinitykinshipkinshipskinswomenaffirmaverenunciatelimnnarratedeclaredelineatedemonstratedescribeprefigurereciterecountrehearserelatereputescrivetellescribingnarratingarticulatingdecorticatingdesiccatingelaqueateepitomizingexplicatingaffluxappetitesmindednesspropendencytendencyardent desirestrong desirehabitudeinclinationinducementlikingpleasurepredispositionwishalluresalureobdurenessagencyagentbrokerinstrumentintermediarymeansmediummiddlemanmotivereasonrelationshipsakeaggregate numberconcurrenceconfluencecouplingcounterpartjoinderjoiningjointjunctionlimbmachinationmatchpairpatchseamadditioncontenderinosculationjunctureknuckleknuckle jointmarrowsolderingsumsuturetotalvampaddlesfoldedjoiningsjointsfolded upagrarianagriculturefree holdmanorlandholdingzamindarizamindariszamindaryzemindarizemindariszemindaryaggrandizementcomprehensivenessdilatationhugenessroominessvastnessareabreadthdimensionexpanseexpansionextentgaugeinfinitylargenesslatitudequantityscopespreadwidthexpansivenessextensivenessenlargesenlargingvastitudevastitudesvastitydiffusibilityextanceexundationostensibilityahcompunctionalasdejectiongriefmelancholyregretremorserueruthsadnesssorrowwellawayregretfulwoefulnesspitiedregreetsaddenssorryishagriefwoe begoneairingdiscursiondisport fungarlichomesteadoutingrambleamusementcontentedcontentmentexcursionjauntrecreationsatiatedsatisfiedstrolltiredtripwalkjogglesjogsserrtourapparitioncontoureffigy emblemfacefigureguiseidealinementmakemannersemblanceappearanceaspectdiagramfeatureformformationgestaltget upimagemakingmodemodelnumeralpatternshapevarietywayshape upamorphismapplicabilityapplicationbearingputureattaminatelabentcommonfieldlistmadianmaidarace coursearenagroundopen fieldplainarenasarenationsdistancespellwhileagedelaydurationlengthperiodtermtimefloor planesurfacelevelsarmedcincturegirdlewaist bandzonesashzostercummerbundbandagecompressfarmgirthholdingligamenligaturetableteachingtenurebandbeltclampdeceptiondeligationeye washfraudheadbandinklekerseylathlinepartplasterrandribbonrowscreedstrapstripstripetabtapethongtrickstipestreepputtistripierstripingsstroutyirdedpateestrippetstryphnicbanglecorbeljoistrafterversebeamhardshipkeensufferingkadibaronyfiefseigniorydistrictestatejaghirjaghirejaghirsjagirjagirswakemanbatchdrivelspitspwalbulkheaplotmasssalivaspittlesputumwholesalesalivarysalivationsaligotssalivassalivatesspatstelesalethowelthoricblockadecircumvolutioncirclecircuitcloseempalementleaguorobsessionoccupancyambitboundarybrimfencehemlinehoopsiegeembacesbuilderjurisprudencekingdomkingshipmasonbricklayerdominiongovernmentrealmreignruleswayrajcarkmindfulnessmuseadviceconceptioncounselimaginationnotionopinionreflectionsolicitudestewthoughttroublewonderworryclapdangerknockerraptappetfearknockqualmswitchtapthudcantonalchateaupalacechieffunctionjurisdicationoptionpicksupersedeabbreviationadoptionauthoritychoicecontroldiscretionimprimaturjurisdictionpowerpossessivenessauthorismobreptionclitoriscircumambulatehoverroamrovewheelrevolverotatetoddleturnturn roundwanderwobbleyawchurninghang aroundsparringswerveswervingtwistingwhirlingwhirraswirlbesmuttingchauntingchorusingchurningscrimpingfoistingintervolvepervadingroupingspinkstroamingswindlingthirlthirlingtwaddlingtwillingtwingingtwiningtwinkingtwiretwirliesttwirlingvolitatingwaltzingwanderoowandlewaukingwhistingwhomblingwobblierwobblingsembushroching caskstrowlvarkcircumlocutiondisk roundaboutspinvertifinousnessvertigocyclegiddinessgyreindirectnessmisfortuneperplexityrevolutionslewswoonwhirlwhirlwindambivalencecircumflexcircumflex humeral arterycircumlocutiouscyclicityclourscyclusoutclassesroundelaysroundingsroundsvagabondsvagilitycharactlupercalroundsphereorborbitroundelcircletspheresoceansurroundingcircumambientcircumferenceencompassingunabridgedambageambientambientsconstituencyverticilannulusfraternitygrouploopnooseringwardzonulehalakahclutchencroachmentgraspgripholdkeepingmanubriummasteryoccupationhafthandlehilthingepossessingpossessionseizuretenementusurpationhinge uponcapturesgrabensoccupanceoccupiescapottedconstuprationepiscopatedobductionobovalpossessionarypossessivalclimeterritorycountryregionpack clothshacklecopulahandfastseizingtiezipfastenersfasteningsconsensushumanitypitycommiserationkindlinesskindnesssympathyempathiseempathizekindheartednesssuffragismsympathectomysympatrysymploceempathiesempathisesoutpassionsympathiessymplastempassionintemeratenessintemperancyintemperaturecontainedapplicableloadedcontentsconstructionpurportspurportstrainedaimimportintentintentionmeaningobjectpurposesensemeanlyimplyingmeanermeanesmeaniesmeanwhilescontexttenoragreementarrangementmethodordersystemcontingentpiecequotasegmentdealdoleingredientportionquantumsectionsharetakepartakespartitivespartagecontritioncostiveholderoccupieroccupanttenanttenantsastringentconstipatinglandholderpossessivepossessorecstasyrapturethisaffaircircumstanceinstantlifepredicamentpresentpresent tensevitalitykeepcaseplighttrimconfigurationmoralbehaviourcharacterchiccuttingdemeanourfashionfoundinggarbstylevoguemodiusmodussceattcropculturecultivated landcultivationtilthdiffidencedismayjeopardymisgivingobsessthreatdoubtdreadinsecurityperildiocese bailiwickempire mastershipministryadministrationgovernanceregimeregimentgovdiversion coildifferencedilemmafoldmazetorsiontwistwindingyawnflakecrustlayerstratumtrayworldperiodatetenuresear ring intorsiontwineearth geoglobeimmovablelandsoilterrapresidentshipsovereigntystatehoodimperiumprincipalityemparadisesultanesssultanshipaldermancyaldermanshipempairemprisingemprisondomainownershippropertyownedproprietorshipproprietressproprioceptionconsortismownershipspossessoryentorganismentortilationproprietiesfeud companycontestantcorpspartytroopfilelineagerangechainpedigreepurviewqueuesequenceseriessuccessionstreelfuselagecavityestimatepitasthrashedthrashesglorymagnificencemajestydignityeleganceeminencegrandeurpompshanshawnseanmourningchagrindolourinfelicityteenunhappinesswoegrieggriecegriecesgriefsmorationsorrancegrudgehostilitytaxanimosityantagonismill feelingintrigueloveplotrelevancyloggemonopolyillustriousnesspageantryjuxtapositionaccessibilityclosenessintimacynearnesspropinquityproximityproxyshipalliancestringthreadcontactualmammonmoneyfortunelucremoolahopulencepelfricheswealthduluthwealthinessrichensrichessedealthtamperaccesscompetenceentryintrusionknowledgeproficiencyreachskillintortionpathwayhabitportnetworkingrichnessemirshippanzersattachedconnectedrelatablerelatedannexalannexationalcorrelativityregardantrespectivepertainingrelapsersrelatersrelativalrelativistrelatorrelatorsannexerincorrespondingreglementaryrelationistrelevationcircinatecircularisecircularizecircumfusecircumscribeprowlcirclingcirclingscircuitingdetouringorbingorbitingrevolvencyrouseaboutvrouwyerkingcircumagitatecircumambagecircumambiencycircumfercircumflectingcircumflexingcircumlittoralcircumnavigatingcircumrotationcircumscribingcircumvallationcircumvolvingincircletpercolatingpericlitatepericlitationrivalingroundaboutnessshoulder beltcurlringletstraplikestrappingleashesleashingstrackstrampstraplinestrappedabodeasylumgoallimitmansionproper placefilosequashingspartanssufferanceenduranceincurrencepatiencetolerancetolerationenduringnesslong sufferancelong sufferingendurancestenancyterrainnationdropping inhaulagepreambulationvisitiingvenuebelongastronomygenrelineamentphysiqueassignmentdedicationattributionjurisdictionaljurisdictiveterra firmaearthshakingforelandhinterlandcornlandcornlandsforelandslandladieslandwindmainlandermainlandscontextualismconcoursesconteckcontessacontextscontexturecontexjoinedunionbrewingsthrawsconqueringdegreefitkettledrumopportunitypitchwatchoccasionquartersectorprovince
Idioms related to the meaning of Elaqa - علاقہ
What are the meanings of Elaqa - علاقہ in English?
Meanings of the word Elaqa - علاقہ in English are affinity, appertain, area, circle, concern, diocese, district, holding, jurisdiction, manor, nexus, rapport, seigniory, tenure, territory, zone, bearing, connection, locality, parvenue, province, region, relation, relevancy, state, terrine, zonule, terrane, territ, terreity and territoried. To understand how would you translate the word Elaqa - علاقہ in English, you can take help from words closely related to Elaqa - علاقہ or it’s English translations. Some of these words can also be considered Elaqa - علاقہ synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Elaqa - علاقہ. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Elaqa - علاقہ in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Elaqa - علاقہ in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Elaqa - علاقہ with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by elaqa?
Meanings of elaqa are affinity, appertain, area, circle, concern, diocese, district, holding, jurisdiction, manor, nexus, rapport, seigniory, tenure, territory, zone, bearing, connection, locality, parvenue, province, region, relation, relevancy, state, terrine, zonule, terrane, territ, terreity and territoried
Whats the definition of elaqa?
Definition of the elaqa are
- (anthropology) kinship by marriage or adoption; not a blood relationship
- be a part or attribute of
- a part of a structure having some specific characteristic or function
- the extent of a 2-dimensional surface enclosed within a boundary
- a part of an animal that has a special function or is supplied by a given artery or nerve
- a subject of study
- a particular geographical region of indefinite boundary (usually serving some special purpose or distinguished by its people or culture or geography)
- a particular environment or walk of life
- an unofficial association of people or groups
- any circular or rotating mechanism
- a curved section or tier of seats in a hall or theater or opera house; usually the first tier above the orchestra
- ellipse in which the two axes are of equal length; a plane curve generated by one point moving at a constant distance from a fixed point
- something approximating the shape of a circle
- movement once around a course
- a road junction at which traffic streams circularly around a central island
- street names for flunitrazepan
- travel around something
- form or draw a circle around
- move in a circular path above (someone or something)
- the territorial jurisdiction of a bishop
- a region marked off for administrative or other purposes
- regulate housing in; of certain areas of towns
- something owned; any tangible or intangible possession that is owned by someone
- the act of retaining something
- the landed estate of a lord (including the house on it)
- the mansion of a lord or wealthy person
- the means of connection between things linked in series
- a connected series or group
- a relationship of mutual understanding or trust and agreement between people
- the position and authority of a feudal lord
- the estate of a seigneur
- the right to hold property; part of an ancient hierarchical system of holding lands
- the term during which some position is held
- give life-time employment to
- a region marked off for administrative or other purposes
- an area of knowledge or interest
- the geographical area under the jurisdiction of a sovereign state
- regulate housing in; of certain areas of towns
- (anatomy) any encircling or beltlike structure
- an area or region distinguished from adjacent parts by a distinctive feature or characteristic
- any of the regions of the surface of the Earth loosely divided according to latitude or longitude
- separate or apportion into sections
- a locally circumscribed place characterized by some distinctive features
- dignified manner or conduct
- a rotating support placed between moving parts to allow them to move easily
- relevant relation or interconnection
- (of a structural member) withstanding a weight or strain
- the act of bringing two things into contact (especially for communication)
- the state of being connected
- a connecting shape
- the process of bringing ideas or events together in memory or imagination
- a relation between things or events (as in the case of one causing the other or sharing features with it)
- shifting from one form of transportation to another
- a supplier (especially of narcotics)
- (usually plural) a person who is influential and to whom you are connected in some way (as by family or friendship)
- a surrounding or nearby region
- of or characteristic of a parvenu
- characteristic of someone who has risen economically or socially but lacks the social skills appropriate for this new position
- the territory occupied by one of the constituent administrative districts of a nation
- the proper sphere or extent of your activities
- a part of an animal that has a special function or is supplied by a given artery or nerve
- the extended spatial location of something
- a knowledge domain that you are interested in or are communicating about
- a large indefinite location on the surface of the Earth
- the approximate amount of something (usually used prepositionally as in in the region of')
- an act of narration
- an abstraction belonging to or characteristic of two entities or parts together
- (usually plural) mutual dealings or connections among persons or groups
- (law) the principle that an act done at a later time is deemed by law to have occurred at an earlier time
- a person related by blood or marriage
- sexual activity between individuals, especially the insertion of a man's penis into a woman's vagina until orgasm and ejaculation occur
- the relation of something to the matter at hand
- the territory occupied by a nation
- a politically organized body of people under a single government
- put before
- the federal department in the United States that sets and maintains foreign policies
- the way something is with respect to its main attributes
- the group of people comprising the government of a sovereign state
- the territory occupied by one of the constituent administrative districts of a nation
- a state of depression or agitation
- (chemistry) the three traditional states of matter are solids (fixed shape and volume) and liquids (fixed volume and shaped by the container) and gases (filling the container)
- indicate through a symbol, formula, etc.
- a pate or fancy meatloaf baked in an earthenware casserole
- small beltlike zone
- وہ کیمیائی قُوَّت جو مالی کیول میں ایٹموں کو یکجا رکھتی ہےمشابہت
- کوئی ہَموار زَمين جِس کی حَد بَندی کی گئی ہو
- فيصلَہ صادَر کَرنے کا اِختِيار
What is the synonym of elaqa?
Synonym of word elaqa are نسبت, سمبندھ, اشتراک, کَشِش, مماثلت, قرابت داری, انس, ربط, سروکار, لگاوٴ
What are the idioms related to elaqa?
Here are the idioms that are related to the word elaqa.
- By bearing with others you shall be borne with
- The devil is a busy bishop in his own diocese
- A bad connection
- A good friend is my nearest relation
- In a state of nature