Hukumat - حکومت meanings in English
Hukumat - حکومت meanings in English are district, state, rule, regiment, regime, power, government, governance, dominion, authority, administration, ministry, mastership, empire, gov Hukumat - حکومت in English. More meanings of hukumat - حکومت, it's definitions, example sentences, related words, idioms and quotations.
district state rule regiment regime power government governance dominion authority administration ministry mastership empire gov
Hukumat - حکومت Definitions
Please find 78 English and 1 Urdu definitions related to the word Hukumat - حکومت.
- (noun) : a region marked off for administrative or other purposes
- (verb) : regulate housing in; of certain areas of towns
- (noun) : an eating apple that somewhat resembles a McIntosh; used as both an eating and a cooking apple
- (noun) : a group of countries under a single authority
- (noun) : a monarchy with an emperor as head of state
- (noun) : the domain ruled by an emperor or empress; the region over which imperial dominion is exercised
- (noun) : the position of master
- (noun) : the skill of a master
- (noun) : building where the business of a government ministry is transacted
- (noun) : religious ministers collectively (especially Presbyterian)
- (noun) : the work of a minister of religion
- (noun) : a government department under the direction of a minister of state
- (noun) : something regarded as a normative example
- (verb) : decide on and make a declaration about
- (noun) : a rule or law concerning a natural phenomenon or the function of a complex system
- (noun) : a basic generalization that is accepted as true and that can be used as a basis for reasoning or conduct
- (noun) : measuring stick consisting of a strip of wood or metal or plastic with a straight edge that is used for drawing straight lines and measuring lengths
- (noun) : a principle or condition that customarily governs behavior
- (noun) : (mathematics) a standard procedure for solving a class of mathematical problems
- (noun) : any one of a systematic body of regulations defining the way of life of members of a religious order
- (noun) : prescribed guide for conduct or action
- (noun) : directions that define the way a game or sport is to be conducted
- (noun) : (linguistics) a rule describing (or prescribing) a linguistic practice
- (noun) : the duration of a monarch's or government's power
- (noun) : dominance or power through legal authority
- (verb) : keep in check
- (verb) : have an affinity with; of signs of the zodiac
- (verb) : decide with authority
- (verb) : mark or draw with a ruler
- (verb) : exercise authority over; as of nations
- (noun) : the persons (or committees or departments etc.) who make up a body for the purpose of administering something
- (noun) : the act of meting out justice according to the law
- (noun) : the act of administering medication
- (noun) : a method of tending to or managing the affairs of a some group of people (especially the group's business affairs)
- (noun) : the tenure of a president
- (noun) : the act of governing; exercising authority
- (noun) : an administrative unit of government
- (noun) : freedom from doubt; belief in yourself and your abilities
- (noun) : official permission or approval
- (noun) : the power or right to give orders or make decisions
- (noun) : an authoritative written work
- (noun) : an expert whose views are taken as definitive
- (noun) : (usually plural) persons who exercise (administrative) control over others
- (noun) : a region marked off for administrative or other purposes
- (noun) : dominance or power through legal authority
- (noun) : one of the self-governing nations in the British Commonwealth
- (noun) : the persons (or committees or departments etc.) who make up a body for the purpose of administering something
- (noun) : the act of governing; exercising authority
- (noun) : the study of government of states and other political units
- (noun) : the organization that is the governing authority of a political unit
- (noun) : (government) the system or form by which a community or other political unit is governed
- (noun) : the act of governing; exercising authority
- (noun) : possession of the qualities (especially mental qualities) required to do something or get something done
- (noun) : a very wealthy or powerful businessman
- (noun) : physical strength
- (noun) : energy made available by the flow of electric charge through a conductor
- (noun) : a mathematical notation indicating the number of times a quantity is multiplied by itself
- (noun) : a state powerful enough to influence events throughout the world
- (noun) : possession of controlling influence
- (noun) : (of a government or government official) holding an office means being in power
- (verb) : supply the force or power for the functioning of
- (noun) : (physics) the rate of doing work; measured in watts (= joules/second)
- (noun) : the organization that is the governing authority of a political unit
- (noun) : (medicine) a systematic plan for therapy (often including diet)
- (noun) : army unit smaller than a division
- (verb) : assign to a regiment
- (verb) : form (military personnel) into a regiment
- (verb) : subject to rigid discipline, order, and systematization
- (noun) : the territory occupied by a nation
- (noun) : a politically organized body of people under a single government
- (verb) : put before
- (noun) : the federal department in the United States that sets and maintains foreign policies
- (noun) : the way something is with respect to its main attributes
- (noun) : the group of people comprising the government of a sovereign state
- (noun) : the territory occupied by one of the constituent administrative districts of a nation
- (noun) : a state of depression or agitation
- (noun) : (chemistry) the three traditional states of matter are solids (fixed shape and volume) and liquids (fixed volume and shaped by the container) and gases (filling the container)
- (verb) : indicate through a symbol, formula, etc.
- بلوائیوں کے عائد کردہ ضابطے
More words related to the meanings of Hukumat - حکومت
More words from English related to Hukumat - حکومت
View an extensive list of words below that are related to the meanings of the word Hukumat - حکومت meanings in English in English.
abetmentaidfurtheranceministrationministrysubsidiarysubserviencesubsurviencesupportancesupportmentsupputationaccompanimentconditioneventstanceaccountaffectionmoodnarrativenatureparticularspositionpostureprospectqualityremarkreportsituationstatestatementstoryactactionconscienceenemafunctionmotionoperationalperceptionadministrationdeedeffectexecutionexorcismexploitfeatgestmeasurenounoperation ... practiceprocedureprocessworkworkingactuationsadherencesenactionsimplementsimpletionimpletionsprocessesprosesadactproceresaccentaccentuationcapabilitycompulsionemphasisenergyfaculty forceimpetuosityimpetuslustinessmainmightpeprampancystressvehemencevervvervevimassertionauthoritycoercioncogencyeffortexertioninertiainfluenceinsistenceinvigorationpersistencepossepowerpressureshovestrengththrustvigourzapzingeffetenessemphlysesemphlysisthrustingsthrustsstreaffirmaverenunciatelimnnarratedeclaredelineatedemonstratedescribeprefigurereciterecountrehearserelatereputescrivetellescribingnarratingarticulatingdecorticatingdesiccatingelaqueateepitomizingexplicatingassistancecontributionhelpaidanceaidancesapparitioncontoureffigy emblemfacefigureguiseidealinementlikenessmakemannersemblancesimilitudeappearanceaspectdiagramfeatureformformationgestaltget upimagemakingmodemodelnumeralpatternshapevarietywayshape upamorphismappertainconcerndiocese districtmanorrapportseigniorytenureaffinityareabearingcircleconnectionholdingjurisdictionlocalitynexusprovinceregionrelationrelevancyterritoryzonezonuleparvenueterrineterraneterritterreityterritoriedarrivalaccessadmissioncapacityextentrangereachsagacitybaronyfiefbuilderjurisprudencekingdomkingshipmasonbricklayerdominiongovernmentrealmreignruleswayrajcannondutifulobligationsstatutecanonharplawordinanceregulationsystemlawslawklawkslawmlawndcasuistlegislatorpatriarchreformermujtihadcabinetcabinetrycantonalceremonialcustomtraditionceremonyformalityhabitudeinstituteordinationritualwontrit.ritualiseritzyrittersrittingrittsritualizesritziestconstitutionusagechiefjurisdicationoptionpicksupersedeabbreviationadoptionchoicecontroldiscretionimprimaturpossessivenessauthorismobreptioncircuitconstituencygirdleleaguorverticilambitannulusfraternitygrouphooploopnooseringwardzosterhalakahclutchencroachmentgraspgripholdkeepingmanubriummasteryoccupancyoccupationhafthandlehilthingeknuckle jointpossessingpossessionseizuretenementusurpationhinge uponcapturesgrabensoccupanceoccupiescapottedconstuprationepiscopatedobductionobovalpossessionarypossessivalclutchesmightinessvaliantabilitygutinputtantamountvaliantnessvisentirenesspotencepoweredpowerfulnessshaktistrenuositypotentisepoweringpowteredboweriesentiertypotancepotentacypotentnessstreightstrengthyvilityoppressiontaxisconstraintgovernancehegemonysuppressionbilinguousbressumercressesdebardebasingdebouchdowitcherdowserebb downfressplebpressorpretensionsqueak bysqueakingsqueakystilestressorsubduednesssupererogationsuperseduresupersessionundersealunwieldinessappressbludgingboweringbrawsdabbingdabsdauberydauphinessdebarkingdebarrassdebauchersdebauchesdebosheddebouchedebouchingdisbuddingdottinessdowdsdowersdownbowsdubitationinstressinstressedinstressesleantobduredoverbearsoverboiledoverbrowspressfulspressingspressionpressionspressuredpressurespresurmiseregressedregressesrepoussagerepressessqueakerystibinestimesstraesstrainingsstressesstressorssubducetressuretressuredtressurescompressiblenesscompressuredabbdebauchednessdebauchnessdebursedownbeardowressdubiositiesobduceobtensionoppressureostensionoutblushoutbribepreactionpressuragerepercussedstrainablesuperexcrescencesurquedousupridgedpressurisedconductdirectionmanagementarrangementmethodorderorganisationmanageabilitymanageablenessecstasyrapturethisaffaircircumstanceinstantlifepredicamentpresentpresent tensevitalitykeeplikingcaseplighttrimcompanycaptorimpactimpressionmarkruinsigntouchtraceeffervescencyaffectednesseffectivityeffectoreffectuationeffendieffervesceeffervescingimpactiontake effecteffaceseffeireffierceeffingefforceeffrayeffseffulgeseffusesrefluenceseffectioneffectuatingeffectuoseeffeteffluencyconfigurationmoraltenorbehaviourcharacterchiccuttingdemeanourfashionfoundinggarbstylevoguemodiusmodussceattcompressionawepressweightcriterionmaximbaseetiquette formulahabitmannersestablished orderprinciplecubitcubitsdaddleforthcomingarmcommandhandinterferencepatronageprotectionslapsupporthandscussednessobstinacyglorygrandeurillustriousnessmajoritymanlinessmastershippre eminenceold agelargenessnobilityseniorityeldershipgreatnessdreadmajestydignitypompdirectorateregimeregimentbailiwickempire kaiserdomemphrensykingrulershipgovernessyreignsruleredruleringrulershipsgovernablenessrule mongerpresidentshipsovereigntystatehoodstatesmanshipimperiumprincipalityemparadisesultanesssultanshipaldermancyaldermanshipempairemprisingemprisondomainenduranceconfiscationdisciplinegoverningrestraintstintalleviatoryconfiscateseizerconfiseurobtemperpercussedprocinctseisedseisingseizableseizersseizesstubbedconfiscableconfiscatedperculacedestablishmentismnizamnizamssystemsfacilitationdivine poweruniversegeneralglittergleamheatpureragerefulgencetolerationmagnificenceeleganceeminenceshanshawnseancustodyupper handpageantrymammonmoneyfortunelucremeansmoolahopulencepelfricheswealthduluthwealthinessrichensrichessedealthknighthoodknackmasterlinessprioritysenoirvantagesuperioritysupremacyprecedencyexaltsentunesupereminenceumbraeumbreumbrereamburymaistremaistrytenetmotmottoprinciplesprincipiationprinciplingramentpathwayportdominancecountrynationexecutiveadministrateadminicleadminiclesadministratorshipaffluencerichnessastronomygenrelineamentphysiquecodereulecouragepridedegreefitkettledrumopportunitypitchtimeturnwatchprestigerankjahdominategovernlordmastercircarsircarsirkarsirkarsreigning
Idioms related to the meaning of Hukumat - حکومت
What are the meanings of Hukumat - حکومت in English?
Meanings of the word Hukumat - حکومت in English are district, empire, mastership, ministry, rule, administration, authority, dominion, governance, government, power, regime, regiment, state and gov. To understand how would you translate the word Hukumat - حکومت in English, you can take help from words closely related to Hukumat - حکومت or it’s English translations. Some of these words can also be considered Hukumat - حکومت synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Hukumat - حکومت. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Hukumat - حکومت in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Hukumat - حکومت in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Hukumat - حکومت with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by hukumat?
Meanings of hukumat are district, empire, mastership, ministry, rule, administration, authority, dominion, governance, government, power, regime, regiment, state and gov
Whats the definition of hukumat?
Definition of the hukumat are
- a region marked off for administrative or other purposes
- regulate housing in; of certain areas of towns
- an eating apple that somewhat resembles a McIntosh; used as both an eating and a cooking apple
- a group of countries under a single authority
- a monarchy with an emperor as head of state
- the domain ruled by an emperor or empress; the region over which imperial dominion is exercised
- the position of master
- the skill of a master
- building where the business of a government ministry is transacted
- religious ministers collectively (especially Presbyterian)
- the work of a minister of religion
- a government department under the direction of a minister of state
- something regarded as a normative example
- decide on and make a declaration about
- a rule or law concerning a natural phenomenon or the function of a complex system
- a basic generalization that is accepted as true and that can be used as a basis for reasoning or conduct
- measuring stick consisting of a strip of wood or metal or plastic with a straight edge that is used for drawing straight lines and measuring lengths
- a principle or condition that customarily governs behavior
- (mathematics) a standard procedure for solving a class of mathematical problems
- any one of a systematic body of regulations defining the way of life of members of a religious order
- prescribed guide for conduct or action
- directions that define the way a game or sport is to be conducted
- (linguistics) a rule describing (or prescribing) a linguistic practice
- the duration of a monarch's or government's power
- dominance or power through legal authority
- keep in check
- have an affinity with; of signs of the zodiac
- decide with authority
- mark or draw with a ruler
- exercise authority over; as of nations
- the persons (or committees or departments etc.) who make up a body for the purpose of administering something
- the act of meting out justice according to the law
- the act of administering medication
- a method of tending to or managing the affairs of a some group of people (especially the group's business affairs)
- the tenure of a president
- the act of governing; exercising authority
- an administrative unit of government
- freedom from doubt; belief in yourself and your abilities
- official permission or approval
- the power or right to give orders or make decisions
- an authoritative written work
- an expert whose views are taken as definitive
- (usually plural) persons who exercise (administrative) control over others
- a region marked off for administrative or other purposes
- dominance or power through legal authority
- one of the self-governing nations in the British Commonwealth
- the persons (or committees or departments etc.) who make up a body for the purpose of administering something
- the act of governing; exercising authority
- the study of government of states and other political units
- the organization that is the governing authority of a political unit
- (government) the system or form by which a community or other political unit is governed
- the act of governing; exercising authority
- possession of the qualities (especially mental qualities) required to do something or get something done
- a very wealthy or powerful businessman
- physical strength
- energy made available by the flow of electric charge through a conductor
- a mathematical notation indicating the number of times a quantity is multiplied by itself
- a state powerful enough to influence events throughout the world
- possession of controlling influence
- (of a government or government official) holding an office means being in power
- supply the force or power for the functioning of
- (physics) the rate of doing work; measured in watts (= joules/second)
- the organization that is the governing authority of a political unit
- (medicine) a systematic plan for therapy (often including diet)
- army unit smaller than a division
- assign to a regiment
- form (military personnel) into a regiment
- subject to rigid discipline, order, and systematization
- the territory occupied by a nation
- a politically organized body of people under a single government
- put before
- the federal department in the United States that sets and maintains foreign policies
- the way something is with respect to its main attributes
- the group of people comprising the government of a sovereign state
- the territory occupied by one of the constituent administrative districts of a nation
- a state of depression or agitation
- (chemistry) the three traditional states of matter are solids (fixed shape and volume) and liquids (fixed volume and shaped by the container) and gases (filling the container)
- indicate through a symbol, formula, etc.
- بلوائیوں کے عائد کردہ ضابطے
What is the synonym of hukumat?
Synonym of word hukumat are علاقہ, تعلقہ, ضلع کا, حلقہ, ضلع, عمل داری, حکومت, کاوٴنٹی, ضلعوں میں تقسیم کرنا, فرماں روائی
What are the idioms related to hukumat?
Here are the idioms that are related to the word hukumat.
- Men rule the world women rule men
- Petticoat government
- In a state of nature
- Many laws in a state are a bad sign
- Reason and authority the two brightest lights of the earth