Aiyaash - عیاش meanings in English
Aiyaash - عیاش meanings in English are dissolute, voluptuous, roister, dedicated to pleasure, petulant, luxurious, licentious, lascivious, debauchee, rake, rally, rakish, rakehell, prostitude, lewd, lecherous, lecher, dissipated, libertine Aiyaash - عیاش in English. More meanings of aiyaash - عیاش, it's definitions, example sentences, related words, idioms and quotations.
dissolute voluptuous roister dedicated to pleasure petulant luxurious licentious lascivious debauchee rake rally rakish rakehell prostitude lewd lecherous lecher dissipated libertine
Aiyaash - عیاش Definitions
Please find 40 English and 2 Urdu definitions related to the word Aiyaash - عیاش.
- (adjective satellite) : unrestrained by convention or morality
- (adjective satellite) : unrestrained by convention or morality
- (noun) : man with strong sexual desires
- (adjective satellite) : given to excessive indulgence in sexual activity
- (adjective satellite) : suggestive of or tending to moral looseness
- (adjective satellite) : driven by lust; preoccupied with or exhibiting lustful desires
- (adjective satellite) : unrestrained by convention or morality
- (noun) : a dissolute person; usually a man who is morally unrestrained
- (adjective satellite) : lacking moral discipline; especially sexually unrestrained
- (adjective satellite) : displaying luxury and furnishing gratification to the senses
- (adjective satellite) : ostentatiously rich and superior in quality
- (noun) : a dissolute man in fashionable society
- (adjective satellite) : marked by a carefree unconventionality or disreputableness
- (adjective satellite) : marked by up-to-dateness in dress and manners
- (verb) : harass with persistent criticism or carping
- (verb) : call to arms; of military personnel
- (verb) : gather or bring together
- (noun) : the feat of mustering strength for a renewed effort
- (noun) : (sports) an unbroken sequence of several successive strokes
- (noun) : an automobile race run over public roads
- (noun) : a large gathering of people intended to arouse enthusiasm
- (noun) : a marked recovery of strength or spirits during an illness
- (verb) : return to a former condition
- (verb) : gather
- (noun) : a dissolute man in fashionable society
- (verb) : scrape gently
- (noun) : degree of deviation from a horizontal plane
- (noun) : a long-handled tool with a row of teeth at its head; used to move leaves or loosen soil
- (verb) : move through with or as if with a rake
- (verb) : sweep the length of
- (verb) : gather with a rake
- (verb) : level or smooth with a rake
- (verb) : examine hastily
- (adjective satellite) : (of a woman's body) having a large bosom and pleasing curves
- (adjective satellite) : having strong sexual appeal
- (adjective satellite) : displaying luxury and furnishing gratification to the senses
- (noun) : a dissolute person; usually a man who is morally unrestrained
- (adjective satellite) : driven by lust; preoccupied with or exhibiting lustful desires
- (adjective satellite) : easily irritated or annoyed
- (verb) : engage in boisterous, drunken merrymaking
- قانُون يا اِخلاق کی قيد سے آزاد
- نفسانی خواہِشات سے مُتعلِّق
More words related to the meanings of Aiyaash - عیاش
More words from English related to Aiyaash - عیاش
View an extensive list of words below that are related to the meanings of the word Aiyaash - عیاش meanings in English in English.
abandonedbadcorruptcorruptedevilfeloniousgracelessillimpairedmuddynastynaughtprostituderamshacklecontaminateddamageddefectiveflawedkaputmucuousobsceneoffensiveout of orderperversepollutedputidrottenruinedspoiledunchasteuncleanwickedwonkywretchwretchedwryerodeperversivespoilablespoilingworsenedbadasseddefacedimpairingirruptedirruptingmalaxatedmalleatesmelanousmishapped ... perigealscrewedspoilfulspoomingspooredspooringwarstwreakfulwreckfulwrickedwrokenmiswroughtperiledbrazen facebrazenfrontlessqueanrakehellshameproofbare facedbrashimmodestimpertinentimpudentindecentindelicatemalapertunashamedunblushingvulgarincestuousimmomentousdissoluteraffishrantipolerakescamscampscamshoodlumscumvagrantcastawayerrant erraticgadaboutmiscreantrakishribaldslipstringtrollopvagabondvagrantlydestitutehooliganprofligatestragstragglerstrollerwackywandererwaywardwhackystrayfornicator n lecherousviciousactactscarjoblewdmanufacturedutyemploymentmissionprofessionundertakinguseutilityworkbastardyadulteryinfidelityadulterineadulteriesbawdyobscenityexorbitantfoul grossraunchypornopornographicvulgarianlustickobscenerobscenestoraculouspornospornsvulcansvulgariansvulgarisedvulgarisesvulgarsvulgatesvulnvulnedvulningvulnslusticlustricallasciviousbubodiabolicdisimmoralimpiousnaughtyjadishnefariouscasemateembrasurewantonblackguarddrunkardfreethinkerlibertinetoperrindsrundcheekyfunnyvividboldbrightcockycoltishdeepfacetiousflippantflirtfriskygarishgayinsolentkittenishmercurialmischievousperkypertpetulantplayfulsaucysportfultoysomevolatilewittycontemndisgrace disparageoutscornrallycorruptiveguiltymorbidspitefulnoxiousstagnantadultererfornicatorsinnertransgressordefluenttransgressedtransgressionaltransgressiveincontinentrigsinfulcorrupterfomentermutineermutinousfirebrandinfectiousinstigatorinsurgentpeccantvillainousmucificcurvateddandyfashion mongerfopgallantniftybeaubentcrookedcunningcurvedfoppishjauntyraffslycuttingferventfiercefuriousgliblyimpetuousmordaciouspipingpiquantsharp pointedsmartspeedytarttangytempestuoustremendoustrenchantvehementviolentacidacridactiveacutebrainybriskcausticcleveredgyfastfeistyfieryglibhotintensekeenkeen wittedlivelyloudnippingpiercingpoignantpungentquickrapidsharpshrillspicyspryspunkstrongswankwing footedyarezappyzippyacceleratedaculeatedbrakybrisantbrisk upbriskenexpeditiousfipplefurringhecticheft upimpoundingintensifiedlarcenouslasherostensivequickersharpenedsharpyshirtysnappyspadefulspankerspankingspeedingspirantspunkytorrentialacuminatedagoutybriskedbriskenedbriskeningbriskerbriskestbriskingeerierexpeditedexpeditivefadyfastishfastuousfeasterferreousfientflattishflintilyfliskfliskyflongflouncyflukingfurfurousfurzygliskhypurallarkylusklustiermusaceouspaceypalpatedpanderlypanderouspanduratedpandyingpiskyplouteredpulverousquakyquiverishripplierripplinglyripplyruddyingsharkedsharnysharpedsharperssharpishsmittlespanglerspanglingspankinglyspankingsspathulatespatteespatularspatulespeaningspedspeededspeedfulspeedlessspeeredspeiredspewedspewinessspewyspielingspikingspiratedspirewisesplentsplentingspoliatoryspongioussprightingsprucingspuddyspurryspurtlesteedysteenedsteeredstreamystridstriddenstrodestroutingsurfeitedsurgefulswardyupblowinguppingaccouteringblustrousdashydrastyfascetfastigiatedferulaceousimpanatedincendiousincensiveinfandouslusteringpiaculouspulverulentradiousriparioussharp wittedsharplingspatiatespeecespirablespritefulspritelythrettyspeeded upcyprusepicureanrandyvoluptuousgaudyjocundjollysparkishmerrymerrymakerfancifulfrivoloussportivesprightlyplutonichellboundinfernalvillainfourquaternaryamuletfetishmascottalismanpunkpunkahpunkeypunkiepunkspunkythunkbaldricksgambadoespunkahspunkasruffiancadgoonlecheronlookerdissolutely immorallyimpiouslyirreligiouslywantonlyintemperatelicentiouson the waydissipatedfar flungunnaturalpiecemealjadedshattereddrunklustfulmuzzyraptruttishtipsycarelessexcitedhappy go luckyindifferentinebriantintoxicatedmadoverjoyedrampantearth bredflashgrovellermirymiserlyabjectbasecontemptibledogfalleniniquitousinsultablemenialsnideunderfootverminousvilewormyhumifieddegreaseddegummeddemisslyhumilianthummabledisglorifiedenlightenfreckly free manfree mindedfree thinkerfreesubstantiveautonomousindependentat largemendicantnon restrictiveunconqueredunconventionaluncoupledunfetteredunrestrainedfreedmanfreeinglibberfreebasedfreedfreedmenfreersfreesfreetslibeledlibellingliberliberatoryspreedunfreedepicureluxurioussensualistsexysalacioussexualerotetictemptingaphrodisiacgoluptiouslusciousadulterersforniceswooeryobmalefactorjokelaughfemme fataleharlotkamicommysorghumjarkjarljarlsjarsselfishsensualvoluptarymagniloquentmuchprolificrifewantlessabundantamplecopiousoverplentyprostituteflooziejadestallionstrumpetwenchwhorehookerposhof tattoosfleetbraggartvainglorious fellowdiscrediteddisgraceddisreputableshamelesshoarseroughrudeunciviluncourteousroister
Idioms related to the meaning of Aiyaash - عیاش
What are the meanings of Aiyaash - عیاش in English?
Meanings of the word Aiyaash - عیاش in English are dissolute, dissipated, lecher, lecherous, lewd, libertine, licentious, luxurious, prostitude, rakehell, rakish, rally, rake, voluptuous, debauchee, lascivious, petulant, roister and dedicated to pleasure. To understand how would you translate the word Aiyaash - عیاش in English, you can take help from words closely related to Aiyaash - عیاش or it’s English translations. Some of these words can also be considered Aiyaash - عیاش synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Aiyaash - عیاش. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Aiyaash - عیاش in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Aiyaash - عیاش in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Aiyaash - عیاش with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by aiyaash?
Meanings of aiyaash are dissolute, dissipated, lecher, lecherous, lewd, libertine, licentious, luxurious, prostitude, rakehell, rakish, rally, rake, voluptuous, debauchee, lascivious, petulant, roister and dedicated to pleasure
Whats the definition of aiyaash?
Definition of the aiyaash are
- unrestrained by convention or morality
- unrestrained by convention or morality
- man with strong sexual desires
- given to excessive indulgence in sexual activity
- suggestive of or tending to moral looseness
- driven by lust; preoccupied with or exhibiting lustful desires
- unrestrained by convention or morality
- a dissolute person; usually a man who is morally unrestrained
- lacking moral discipline; especially sexually unrestrained
- displaying luxury and furnishing gratification to the senses
- ostentatiously rich and superior in quality
- a dissolute man in fashionable society
- marked by a carefree unconventionality or disreputableness
- marked by up-to-dateness in dress and manners
- harass with persistent criticism or carping
- call to arms; of military personnel
- gather or bring together
- the feat of mustering strength for a renewed effort
- (sports) an unbroken sequence of several successive strokes
- an automobile race run over public roads
- a large gathering of people intended to arouse enthusiasm
- a marked recovery of strength or spirits during an illness
- return to a former condition
- gather
- a dissolute man in fashionable society
- scrape gently
- degree of deviation from a horizontal plane
- a long-handled tool with a row of teeth at its head; used to move leaves or loosen soil
- move through with or as if with a rake
- sweep the length of
- gather with a rake
- level or smooth with a rake
- examine hastily
- (of a woman's body) having a large bosom and pleasing curves
- having strong sexual appeal
- displaying luxury and furnishing gratification to the senses
- a dissolute person; usually a man who is morally unrestrained
- driven by lust; preoccupied with or exhibiting lustful desires
- easily irritated or annoyed
- engage in boisterous, drunken merrymaking
- قانُون يا اِخلاق کی قيد سے آزاد
- نفسانی خواہِشات سے مُتعلِّق
What is the synonym of aiyaash?
Synonym of word aiyaash are اوباش, آوارہ, بدکار, لچا, گنڈا, لنگاڑا, شہدا, بد چلن, بدفعل, عیاش
What are the idioms related to aiyaash?
Here are the idioms that are related to the word aiyaash.
- A reformed rake makes the best husband
- Rake up