Marhala - مرحلہ meanings in English
Marhala - مرحلہ Definitions
Please find 44 English and 1 Urdu definitions related to the word Marhala - مرحلہ.
- (noun) : the most important point
- (noun) : a small conspicuous constellation in the southern hemisphere in the Milky Way near Centaurus
- (noun) : the act of traveling from one place to another
- (verb) : undertake a journey or trip
- (verb) : travel upon or across
- (noun) : (nautical) the distance traveled by a sailing vessel on a single tack
- (noun) : one of the supports for a piece of furniture
- (noun) : a structure in animals that is similar to a human leg and used for locomotion
- (noun) : the limb of an animal used for food
- (noun) : a section or portion of a journey or course
- (noun) : a prosthesis that replaces a missing leg
- (noun) : a cloth covering consisting of the part of a pair of trousers that covers a person's leg
- (noun) : a human limb; commonly used to refer to a whole limb but technically only the part of the limb between the knee and ankle
- (noun) : the sound of a step of someone walking
- (noun) : relative position in a graded series
- (noun) : the act of changing location by raising the foot and setting it down
- (noun) : support consisting of a place to rest the foot while ascending or descending a stairway
- (noun) : a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- (noun) : a short distance
- (noun) : any maneuver made as part of progress toward a goal
- (noun) : a sequence of foot movements that make up a particular dance
- (noun) : a mark of a foot or shoe on a surface
- (noun) : a musical interval of two semitones
- (verb) : put down or press the foot, place the foot
- (verb) : walk a short distance to a specified place or in a specified manner
- (verb) : move with one's feet in a specific manner
- (verb) : furnish with steps
- (verb) : cause (a computer) to execute a single command
- (verb) : place (a ship's mast) in its step
- (verb) : move or proceed as if by steps into a new situation
- (verb) : shift or move by taking a step
- (noun) : an effort that is inconvenient
- (noun) : the quality of being difficult
- (noun) : a factor causing trouble in achieving a positive result or tending to produce a negative result
- (noun) : a condition or state of affairs almost beyond one's ability to deal with and requiring great effort to bear or overcome
- (noun) : a hotel providing overnight lodging for travelers
- (verb) : plan, organize, and carry out (an event)
- (noun) : a section or portion of a journey or course
- (noun) : a large coach-and-four formerly used to carry passengers and mail on regular routes between towns
- (noun) : a large platform on which people can stand and can be seen by an audience
- (noun) : a small platform on a microscope where the specimen is mounted for examination
- (noun) : any scene regarded as a setting for exhibiting or doing something
- (verb) : perform (a play), especially on a stage
- (noun) : the theater as a profession (usually the stage')
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
More words related to the meanings of Marhala - مرحلہ
More words from English related to Marhala - مرحلہ
View an extensive list of words below that are related to the meanings of the word Marhala - مرحلہ meanings in English in English.
abstrusedifficultembarrassmentirksomeobstaclepalacepinchpuzzlingthornyabstractarduouscomplicateddifficultydilemmahardhardshiphot waterintricacyintricatenarrowoccultoperosepainfulperplexityproblemsteeptangletenacioustortuoustoughtroubleuphillwearifulwearisomedifficilehardertuskydifficilitatedifficultateabutmentgradepierrundlecantileverfoundation honourlegstatusaccessgangway ... gateroutetrackventwaycoursecustomheadwayjourneymethodpathprogressroadroadmapwentafflictionevilfashgrievousnessillmisadventuremisfortunemishapadversitybalecalamitydisastermiseryplightsufferingvisitationpliancyagencyparoxysmtripconvulsionfitgiddinessitinerancytourailingdiseaseillnessmildewmorbiditybad habitbotherationdefectdisorderentanglementfault infirmitymaladysicknessarduousnessendeavorswotdiligenceexerciseexertionhard worklabourtoiltravailtrialworkcruxdisadvantagehardnessaxistarsustrunkshankceremonialcraftgadgetmachinationmanoeuvremotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductdeceitdeceptionfashiongaitgimmickryguileindirectionruseshenaniganstratagemtactictricktrickerywalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackcoagulumglandjoiningjointknobknurlbunchknotknucklenodenodositypackagesnagsnarltietuberstonguechumplumpfishrhinorrheaballadistsknospslumpkinlumpkinslumpscoachmarchdepartureegressexoduscoachwhipkocharmlocksarmorsarmurearmurescoachyconundrumgruelimplexionimplicationkinkwater gruelcoilcomplicationconjeecurlcurvefoldindirectnessintorsionnullscrewslewtorsiontwistvolutionwimplepaschpatchedpatchingpatchoulyschlockscrewingbachingleachesmatchetspatchespatchingspatchworkspaunchespechpechsperchingpleuchscreaksscreechesscreichscreighscrewerscrewingsscrewsscrowsscutchscutchesspewstachesboltenigmalabyrinthmysterynodulenodusdiscomfortgrievanceburdendolourharassmenthurtinconvenienceinflictionjarpainsufferanceteentortureuncomfortablenessachingaffricationdistressfulnessdistressingnessincipienceincompressibilitytackinesstactilitytransiencyaffecteraggrievesanguiformdisparagesinconyrecomfortsufflationacrimoniousnessafflictednessdisconveniencediscumbencydistressednessdisturbationincompassionmiscomfortprobalityrecomforturesuffrancetransiliencequandaryemblemmarkmottosemblancecarvingcharmengravingfeaturesimpressioninscriptionpaintingpicturestampembowelmentpuzzlementimbrogliomazemessmorassnetrestlessnessconfusednessconfoundednessfaregiveholdmakecomegooperatepaceproceedruntreadlikewalkstokingtreadingstreadlingfloor abodedestinationflat goalgreeday's journeylandinglevelmansionobjectivestoreytiertrekfootfeetfoetorfootholdsfootingsfootlingsfootpadsfootrulefootrulesfootsfootsiefootwornoutfootoutfootsfoot pacefootfallfootstepmeasurestridesteedsstetsyardp.a.pahostryhotelrabataubergehostelinnkiptourismtravelvoyagecommutingexpedienceitinerationjourneyingtravetraveledtravelingtravelledtravellingtrip upcommutescruisinggoingsitinerantsitinerateditineratesjourjourneystravelingstripestrivetsvoyagersvoyageurvoyageursdomageitineratingjourney batedwanderingtouristrytourneryvoyagingkickenvenimeleggeleggerlegginesslegistthighsuppressionmeasuresInitiativesterracestagebotherquarrelcalumnycavilobjectionsprouthindrancenoisetumultentrapmentgingraspmeshnoosesnaretrapdistress narrownessworry
Idioms related to the meaning of Marhala - مرحلہ
What are the meanings of Marhala - مرحلہ in English?
Meanings of the word Marhala - مرحلہ in English are crux, journey, leg, step, difficulty, inn and stage. To understand how would you translate the word Marhala - مرحلہ in English, you can take help from words closely related to Marhala - مرحلہ or it’s English translations. Some of these words can also be considered Marhala - مرحلہ synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Marhala - مرحلہ. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Marhala - مرحلہ in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Marhala - مرحلہ in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Marhala - مرحلہ with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by marhala?
Meanings of marhala are crux, journey, leg, step, difficulty, inn and stage
Whats the definition of marhala?
Definition of the marhala are
- the most important point
- a small conspicuous constellation in the southern hemisphere in the Milky Way near Centaurus
- the act of traveling from one place to another
- undertake a journey or trip
- travel upon or across
- (nautical) the distance traveled by a sailing vessel on a single tack
- one of the supports for a piece of furniture
- a structure in animals that is similar to a human leg and used for locomotion
- the limb of an animal used for food
- a section or portion of a journey or course
- a prosthesis that replaces a missing leg
- a cloth covering consisting of the part of a pair of trousers that covers a person's leg
- a human limb; commonly used to refer to a whole limb but technically only the part of the limb between the knee and ankle
- the sound of a step of someone walking
- relative position in a graded series
- the act of changing location by raising the foot and setting it down
- support consisting of a place to rest the foot while ascending or descending a stairway
- a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- a short distance
- any maneuver made as part of progress toward a goal
- a sequence of foot movements that make up a particular dance
- a mark of a foot or shoe on a surface
- a musical interval of two semitones
- put down or press the foot, place the foot
- walk a short distance to a specified place or in a specified manner
- move with one's feet in a specific manner
- furnish with steps
- cause (a computer) to execute a single command
- place (a ship's mast) in its step
- move or proceed as if by steps into a new situation
- shift or move by taking a step
- an effort that is inconvenient
- the quality of being difficult
- a factor causing trouble in achieving a positive result or tending to produce a negative result
- a condition or state of affairs almost beyond one's ability to deal with and requiring great effort to bear or overcome
- a hotel providing overnight lodging for travelers
- plan, organize, and carry out (an event)
- a section or portion of a journey or course
- a large coach-and-four formerly used to carry passengers and mail on regular routes between towns
- a large platform on which people can stand and can be seen by an audience
- a small platform on a microscope where the specimen is mounted for examination
- any scene regarded as a setting for exhibiting or doing something
- perform (a play), especially on a stage
- the theater as a profession (usually the stage')
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
What is the synonym of marhala?
Synonym of word marhala are دشواری, معمہ, پیچ, عقدہ, مرحلہ, مشکل مرحلہ, راہ, دورہ, کوچ, چلنا
What are the idioms related to marhala?
Here are the idioms that are related to the word marhala.
- A journey of a thousand miles begins with one step
- If you tell every step you will make a long journey
- Step after step the ladder is ascended
- Step by step one goes far
- Vice which have grown with us are with difficulty cut away