Chalaana - چلانا meanings in English
Chalaana - چلانا meanings in English are agitate, walk, bellow, initiate, operate, run, stir, weep, yammer, implate, wag, snivel, blew, drive, hollo, hoop, impel, manage, march, move, rant, emball Chalaana - چلانا in English. More meanings of chalaana - چلانا, it's definitions, example sentences, related words, idioms and quotations.
agitate walk bellow initiate operate run stir weep yammer implate wag snivel blew drive hollo hoop impel manage march move rant emball
Chalaana - چلانا Definitions
Please find 182 English and 2 Urdu definitions related to the word Chalaana - چلانا.
- (verb) : try to stir up public opinion
- (verb) : change the arrangement or position of
- (verb) : move or cause to move back and forth
- (verb) : exert oneself continuously, vigorously, or obtrusively to gain an end or engage in a crusade for a certain cause or person; be an advocate for
- (noun) : a series of actions advancing a principle or tending toward a particular end
- (verb) : have certain properties when driven
- (verb) : travel or be transported in a vehicle
- (verb) : proceed along in a vehicle
- (verb) : strive and make an effort to reach a goal
- (verb) : cause to move back by force or influence
- (noun) : the act of applying force to propel something
- (noun) : a journey in a vehicle (usually an automobile)
- (noun) : the act of driving a herd of animals overland
- (noun) : (sports) a hard straight return (as in tennis or squash)
- (noun) : hitting a golf ball off of a tee with a driver
- (noun) : a wide scenic road planted with trees
- (noun) : a mechanism by which force or power is transmitted in a machine
- (noun) : (computer science) a device that writes data onto or reads data from a storage medium
- (noun) : a road leading up to a private house
- (noun) : the trait of being highly motivated
- (noun) : a physiological state corresponding to a strong need or desire
- (verb) : cause to function by supplying the force or power for or by controlling
- (verb) : excavate horizontally
- (verb) : cause to move rapidly by striking or throwing with force
- (verb) : operate or control a vehicle
- (verb) : urge forward
- (verb) : cause someone or something to move by driving
- (verb) : move by being propelled by a force
- (verb) : work as a driver
- (verb) : (hunting) chase from cover into more open ground
- (verb) : (hunting) search for game
- (verb) : hit very hard, as by swinging a bat horizontally
- (verb) : strike with a driver, as in teeing off
- (verb) : push, propel, or press with force
- (verb) : compel somebody to do something, often against his own will or judgment
- (verb) : to compel or force or urge relentlessly or exert coercive pressure on, or motivate strongly
- (verb) : utter a sudden loud cry
- (noun) : a very loud utterance (like the sound of an animal)
- (verb) : cry hollo
- (verb) : encourage somebody by crying hollo
- (noun) : horizontal circular metal hoop supporting a net through which players try to throw the basketball
- (verb) : cause to move forward with force
- (verb) : handle effectively
- (verb) : carry on or function
- (verb) : succeed in doing, achieving, or producing (something) with the limited or inadequate means available
- (noun) : the month following February and preceding April
- (noun) : a steady advance
- (noun) : the act of marching; walking with regular steps (especially in a procession of some kind)
- (noun) : a procession of people walking together
- (noun) : a degree granted for the successful completion of advanced study of architecture
- (noun) : genre of music written for marching
- (noun) : district consisting of the area on either side of a border or boundary of a country or an area
- (verb) : force to march
- (verb) : cause to march or go at a marching pace
- (verb) : walk fast, with regular or measured steps; walk with a stride
- (verb) : march in a procession
- (verb) : march in protest; take part in a demonstration
- (verb) : walk ostentatiously
- (verb) : perform an action, or work out or perform (an action)
- (noun) : a change of position that does not entail a change of location
- (noun) : the act of changing location from one place to another
- (noun) : the act of deciding to do something
- (noun) : the act of changing your residence or place of business
- (verb) : dispose of by selling
- (verb) : live one's life in a specified environment
- (verb) : progress by being changed
- (verb) : propose formally; in a debate or parliamentary meeting
- (verb) : have a turn; make one's move in a game
- (verb) : go or proceed from one point to another
- (verb) : arouse sympathy or compassion in
- (verb) : move so as to change position, perform a nontranslational motion
- (verb) : change residence, affiliation, or place of employment
- (verb) : be in a state of action
- (verb) : follow a procedure or take a course
- (noun) : (game) a player's turn to take some action permitted by the rules of the game
- (verb) : cause to move or shift into a new position or place, both in a concrete and in an abstract sense
- (verb) : change location; move, travel, or proceed, also metaphorically
- (verb) : keep engaged
- (verb) : perform as expected when applied
- (verb) : perform a movement in military or naval tactics in order to secure an advantage in attack or defense
- (verb) : direct or control; projects, businesses, etc.
- (verb) : handle and cause to function
- (verb) : perform surgery on
- (noun) : a loud bombastic declamation expressed with strong emotion
- (verb) : talk in a noisy, excited, or declamatory manner
- (verb) : be diffused
- (verb) : flee; take to one's heels; cut and run
- (verb) : include as the content; broadcast or publicize
- (noun) : a race between candidates for elective office
- (verb) : run, stand, or compete for an office or a position
- (verb) : keep company
- (verb) : move along, of liquids
- (verb) : continue to exist
- (verb) : perform as expected when applied
- (verb) : pursue for food or sport (as of wild animals)
- (verb) : cause something to pass or lead somewhere
- (verb) : stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
- (verb) : have a tendency or disposition to do or be something; be inclined
- (verb) : progress by being changed
- (verb) : direct or control; projects, businesses, etc.
- (verb) : compete in a race
- (noun) : a row of unravelled stitches
- (verb) : change or be different within limits
- (noun) : a small stream
- (noun) : a score in baseball made by a runner touching all four bases safely
- (noun) : the act of running; traveling on foot at a fast pace
- (noun) : a regular trip
- (noun) : a short trip
- (noun) : an unbroken chronological sequence
- (noun) : the production achieved during a continuous period of operation (of a machine or factory etc.)
- (noun) : unrestricted freedom to use
- (noun) : the continuous period of time during which something (a machine or a factory) operates or continues in operation
- (noun) : an unbroken series of events
- (noun) : the act of testing something
- (noun) : a race run on foot
- (verb) : cause an animal to move fast
- (verb) : move about freely and without restraint, or act as if running around in an uncontrolled way
- (verb) : deal in illegally, such as arms or liquor
- (verb) : set animals loose to graze
- (verb) : make without a miss
- (verb) : carry out a process or program, as on a computer or a machine
- (verb) : occur persistently
- (verb) : extend or continue for a certain period of time
- (verb) : be affected by; be subjected to
- (verb) : have a particular form
- (verb) : become undone
- (verb) : cause to perform
- (verb) : change from one state to another
- (verb) : be operating, running or functioning
- (verb) : carry out
- (verb) : cover by running; run a certain distance
- (verb) : move fast by using one's feet, with one foot off the ground at any given time
- (verb) : travel rapidly, by any (unspecified) means
- (verb) : run with the ball; in such sports as football
- (verb) : sail before the wind
- (verb) : come unraveled or undone as if by snagging
- (verb) : reduce or cause to be reduced from a solid to a liquid state, usually by heating
- (noun) : (American football) a play in which a player attempts to carry the ball through or past the opposing team
- (verb) : cause to emit recorded audio or video
- (verb) : pass over, across, or through
- (verb) : cry or whine with snuffling
- (noun) : the act of breathing heavily through the nose (as when the nose is congested)
- (noun) : whining in a tearful manner
- (verb) : snuff up mucus through the nose
- (noun) : a rapid active commotion
- (verb) : to begin moving
- (noun) : a prominent or sensational but short-lived news event
- (verb) : move an implement through
- (verb) : summon into action or bring into existence, often as if by magic
- (noun) : causing to move repeatedly from side to side
- (verb) : move from side to side
- (verb) : accompany or escort
- (noun) : (baseball) an advance to first base by a batter who receives four balls
- (noun) : the act of traveling by foot
- (noun) : the act of walking somewhere
- (noun) : a slow gait of a horse in which two feet are always on the ground
- (noun) : a path set aside for walking
- (noun) : manner of walking
- (noun) : careers in general
- (verb) : be or act in association with
- (verb) : live or behave in a specified manner
- (verb) : obtain a base on balls
- (verb) : give a base on balls to
- (verb) : take a walk; go for a walk; walk for pleasure
- (verb) : use one's feet to advance; advance by steps
- (verb) : make walk
- (verb) : traverse or cover by walking
- (verb) : walk at a pace
- (verb) : cry loudly, as of animals
- (noun) : a very loud utterance (like the sound of an animal)
- (verb) : make a loud noise, as of animal
- (verb) : shout loudly and without restraint
- (noun) : United States author (born in Canada) whose novels influenced American literature after World War II (1915-2005)
- (verb) : bring up a topic for discussion
- (noun) : people who have been introduced to the mysteries of some field or activity
- (verb) : take the lead or initiative in; participate in the development of
- (noun) : someone who has been admitted to membership in a scholarly field
- (noun) : someone new to a field or activity
- (verb) : bring into being
- (verb) : accept people into an exclusive society or group, usually with some rite
- (verb) : set in motion, start an event or prepare the way for
- (verb) : shed tears because of sadness, rage, or pain
- چلانا جیسے گاڑی میں بٹھا کر لے جانا
- گھوڑے کا نکالنا یا درست کرنا
More words related to the meanings of Chalaana - چلانا
More words from English related to Chalaana - چلانا
View an extensive list of words below that are related to the meanings of the word Chalaana - چلانا meanings in English in English.
abstinenceairlessbandagebankbreakwatercrampdamimpassableimprisonmentjointletligamenligaturemanacleobstaclepiecepierbondclosedcopuladikedykehoopligamentshuttightunopenedverseweirbound offclose downclose offclose outclosedowncloselippedcloseoutclosingclosing offdiscontinuedetchedfoist offoffhandedshut awayshutoutshutteredshuttingspiel offceasingclosetedcloseting ... closuredcloyedestopinclosesoffedoffingsquitedseinedshutsunclosedclosehandedclosehauledcollopedaccomplishachieveconcludeconsummateeffectuate implementoperatecompletefinishfulfillmake fullaccomptingfulfillingacmecircumscriptionendfrontierlimitoutskirtrangesurpasstermterminusbarrierboundaryedge limitationmarchmarkmeteat mostoutgoingquantityutmostbounderishboundslimitarianlimitourlimuleacquaintapprisewarnadvertisecommunicateinforminitiateactmangrovemouldercommitdomakemake doto rendmovemoseysnapmovingnessactivateactuateactuatesagitatejogkedgeenticeimpelliftarousegalvaniseinstigateinveiglekindlepersuadequickeninstigatingenchafefulminatemaddenstirstirsigniteluntexpiateinciterignitingincitesincitingincineratinginstimulateirrelateaccentuateemphasizeenjoin forceinculcateinsistpressremindurgeaerateballoonblewaffirmationavercalldivulgeenunciatefame nameproposespeakteachadmonishadviseaskassertbiddingdictumorderpromisepronouncesaysayingtellunfoldutteraffiliateconstituteconstructcreateerectfablefabricatefeignfoundframemanufacturemanufacturesmouldbuildcoinconfigureedifyforgelaughproducevampfabricatingmeakingaggrandizedilatedrive educateekeenhance escalatefurthermagnifymultiplyprolongaggrandiseamplifyenlargeexpandextendgrowincreasepreferprotractstep upstretchenhancingestivatingentendfan jogglejoltrocksweeptamewagdomesticatefamiliarisehustlequakerileshakewalkagitationoutbreakoutcryputschdisturbanceexcitementinsurrectionuprisinginsurgenceuprestuprousesairingdiscursiondisport fungarlichomesteadmanoroutingrambleamusementcontentedcontentmentexcursionjauntrecreationsatiatedsatisfiedstrolltiredtripjogglesjogsserrtourconstitutionalwalky talkyoutwalksairsgasconaderantvaingloryvauntboastbragbraggingmountebankeryvauntingbraggyappliancegangwaygategatroadwayroutetrackwaycoursefaremannerpathroadapproach pathestuarialexhausttowing pathestoppagesestopsestrangesestuariesfootwaylanewaypathicpathingroukwayedavertdislocatedisseat drawobviatewarddetachdrive backmove asiderelieveremoverepelshiftstriketake awaydivergingextrapolaterake offtakedowndetractingdisplacingostiolateremigateremigatingremigationpreemptingbangchastisedashdrub flapknocklynchmasterovercomeputtbeathitjugulatekillknucklesmitestrapzaphittingstrokingbashingbatinghitheskippingsloshessmitsmitingsmittingsmoteto beatbreathebreathingbreathgaspinhalerespirebreathalyzebreathe inbreathiestinwreatheresplendedresprayresprayingsuffeteinbreathinginhalentinhiationblowinflateinspiretormentwinnowhisssnakeblockadecircumvolutioncirclecircuitcloseempalementgirdleleaguorobsessionoccupancyambitbrimfencehemlinesiegeembacesbrandishturnveerwheelwhirlwindsquirmvacillatevibratewavewaverwriggleflarequaverquiverswagundulateunfurlwave offhoasthoistingshow offbroilclamorfussmisrulerabblementrumpusaffraycombustionconfusiondisorderfrayhubble bubblemeleeriotruckustumultturmoiluproarcloutturbulencyclombuproarsuprosebudgemove awaysecedewithdrawcrawlslipbustlejubilationburpbelchbellowcarryconveyleadcastigateclapper clawoverpowerhumiliatelay offput to shameratescoldceremonialcraftgadgetmachinationmanoeuvremotionmovementpassagespeedstepstrategysubterfugeactivityanticconductcustomdeceitdeceptionfashiongaitgimmickryguileindirectionruseshenaniganstratagemtactictricktrickerycrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackchallengehootblaredefyprovokeshoutindulgiatecircumambulatehoverroamroverevolverotatetoddleturn roundwanderwobbleyawchurninghang aroundsparringswerveswervingtwistingwhirlingwhirraswirlbesmuttingchauntingchorusingchurningscrimpingfoistingintervolvepervadingroupingspinkstroamingswindlingthirlthirlingtwaddlingtwillingtwingingtwiningtwinkingtwiretwirliesttwirlingvolitatingwaltzingwanderoowandlewaukingwhistingwhomblingwobblierwobblingsembushroching caskstrowlvarkconstituencydistrictverticilannulusareafraternitygrouploopnooseringzonezonulezosterhalakahclowndroll jesuitjokerskitwagglebuffooncomedianjesterjocosejokestertomfoolzanygallopracerunscootcoachdepartureegressexodusjourneycoachwhipkocharmlocksarmorsarmurearmurescoachycryfoot boy globulegrieveruebeweepweepbewailedvailingwappingyawingbewailmentcrushextract oilinsertpush backdiddlestaggerwabblehobblereeltittertottertremblewaveringsdinhollahowlroarscreakhollerscreamsquealyellbewailschouthowlsyellshowpdisciplinedry emaciateinsolateinstructtorrefytraintutordrying updisplacepostponepush asidedistendforerunlengthenmantleoutflyoutnumberoverstepthrivevegetatewaxknitmountnoseproceedprosperdespatchdispatchsenddisplacementgesturevibrationwaftdisentangle levigatedilutedisolvedissolveliquefymeltresolvesolveresolvingsolmizatesolvingworking outredressingsolvatingdrift flowflushglidejetdribblerunnyflowshurtlejustledingjaculatejostleshove offfleerun awaybreak awaybreakawayspear upfleighgorepairtravelforgoingpervefleetmizzlechasedisperseenforceearnestnessfervencykeennesspepzealdiligencelivelinessvehemenceactivismegoismjactationquackerydangsgoingleavesmoothnesscoursingdepartercoursingsdepartersdepartingsdepartsdeparturesdepartableempaleencircleenvironimmureimpenimpoundbesiegeblockclipcompasscomprehendencloseenfoldfillhedgeincludeinvestobsessoccupysurroundencainideencirclingenclotheenclaspingencreasingeructationdakarescapedecampdisappearvamosefacetioushumoristhumorsomecomicfine humourousjocularsubtlewittyzarfgiveholdcomepacetreadlikewalkstokingtreadingstreadlingprowledprowlsrableback outcirculatedivagatetwistreverbingfawnferrulelugflitborderconfineborderlinefunnymirthfulteaserwaggishgabbleprattleto be soldtempovelocityspeedinesspacesspeansspeedsspeedstersvelocitiesspecesperagestoppageactionfault gestgesticulationmischiefmotioningcoilringletcoilsgrabattackboundcatch a ballclawclutchdartflashhentlaunchmake hastepulsatesnatchspringthroblippinghollocomplaincry outevokehailhalloomustersummonpishrebukereprimandreprovescouthoundprotrudebuntjerkkickpokepropelshoveblaizeblowesspushwhetmaintainmoderateassistcatchcurbhelphold uplook aftermanagepunishretrieveset rightsupportsustaintake care oftake overembalmmentpropagatescontinuekeep upperpetuatecontinuing trespassministersuperviseadministerarrangedisposeliquidatearrangingoverseelignificationmarchemarchesmarchingmarchesesstridedepartforsakemarch outmiscalltauntcurserevileslatetrouncevituperatemodulatecontrolheftpacifypoiserestrainstopmournbewailkeenlamentwailyammerbemoanbemoanersbemoaningbemoaningsbemoilbewailingbewailingslamentingsoscillateditheringfizzingmoldymuckleclowmullingnouldslakingdeathdemisemigrationpassing awaytransfertransportationsuppressionmeasuremeasuresInitiativesjigglejog trotjoggingnudgerspoutingtwig blightgiggedgigginggigglinggigglyjaggingjiggeringjiggingjinkingjockeyingjoggedjoggledjogglingjollingjookingjuggingledgeringloutingnudgingtwiggiertwiggiesttwiggingziggingembulkquallingnugacitypalaverprevaricatepromenadetenorhabithabitudefuriesswayingsperambulationpatricidespatrolsprotestscreechslidesnivelstimulateinstallmake wayyieldtalktalkingtaradiddlecrackerfibgossipprittle prattletattlevapouringyarngalopwaterabductdispelimbrueimbuemoilsaturateexecutionongoingoperationproceedingworkingbarking atchastisementharanguehumiliationlashlessonscoldingtiradebegincommenceinductstartStartupsgincomminatecommiserativeinitializeoriginatecommeasureinitiatingstartishusheringoriginatingwithsetcommotionpyrolignouscheckmatefillipincitepromptgrumblecomplanategrousedithershuddergoadexpeloustacquitewieldgimmickedgimmickinggimmickyplonkingprocliveumbilicationpractisetreatact outdeededdeeding
Idioms related to the meaning of Chalaana - چلانا
What are the meanings of Chalaana - چلانا in English?
Meanings of the word Chalaana - چلانا in English are agitate, blew, drive, hollo, hoop, impel, manage, march, move, operate, rant, run, snivel, stir, wag, walk, yammer, bellow, initiate, weep, implate and emball. To understand how would you translate the word Chalaana - چلانا in English, you can take help from words closely related to Chalaana - چلانا or it’s English translations. Some of these words can also be considered Chalaana - چلانا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Chalaana - چلانا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Chalaana - چلانا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Chalaana - چلانا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Chalaana - چلانا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by chalaana?
Meanings of chalaana are agitate, blew, drive, hollo, hoop, impel, manage, march, move, operate, rant, run, snivel, stir, wag, walk, yammer, bellow, initiate, weep, implate and emball
Whats the definition of chalaana?
Definition of the chalaana are
- try to stir up public opinion
- change the arrangement or position of
- move or cause to move back and forth
- exert oneself continuously, vigorously, or obtrusively to gain an end or engage in a crusade for a certain cause or person; be an advocate for
- a series of actions advancing a principle or tending toward a particular end
- have certain properties when driven
- travel or be transported in a vehicle
- proceed along in a vehicle
- strive and make an effort to reach a goal
- cause to move back by force or influence
- the act of applying force to propel something
- a journey in a vehicle (usually an automobile)
- the act of driving a herd of animals overland
- (sports) a hard straight return (as in tennis or squash)
- hitting a golf ball off of a tee with a driver
- a wide scenic road planted with trees
- a mechanism by which force or power is transmitted in a machine
- (computer science) a device that writes data onto or reads data from a storage medium
- a road leading up to a private house
- the trait of being highly motivated
- a physiological state corresponding to a strong need or desire
- cause to function by supplying the force or power for or by controlling
- excavate horizontally
- cause to move rapidly by striking or throwing with force
- operate or control a vehicle
- urge forward
- cause someone or something to move by driving
- move by being propelled by a force
- work as a driver
- (hunting) chase from cover into more open ground
- (hunting) search for game
- hit very hard, as by swinging a bat horizontally
- strike with a driver, as in teeing off
- push, propel, or press with force
- compel somebody to do something, often against his own will or judgment
- to compel or force or urge relentlessly or exert coercive pressure on, or motivate strongly
- utter a sudden loud cry
- a very loud utterance (like the sound of an animal)
- cry hollo
- encourage somebody by crying hollo
- horizontal circular metal hoop supporting a net through which players try to throw the basketball
- cause to move forward with force
- handle effectively
- carry on or function
- succeed in doing, achieving, or producing (something) with the limited or inadequate means available
- the month following February and preceding April
- a steady advance
- the act of marching; walking with regular steps (especially in a procession of some kind)
- a procession of people walking together
- a degree granted for the successful completion of advanced study of architecture
- genre of music written for marching
- district consisting of the area on either side of a border or boundary of a country or an area
- force to march
- cause to march or go at a marching pace
- walk fast, with regular or measured steps; walk with a stride
- march in a procession
- march in protest; take part in a demonstration
- walk ostentatiously
- perform an action, or work out or perform (an action)
- a change of position that does not entail a change of location
- the act of changing location from one place to another
- the act of deciding to do something
- the act of changing your residence or place of business
- dispose of by selling
- live one's life in a specified environment
- progress by being changed
- propose formally; in a debate or parliamentary meeting
- have a turn; make one's move in a game
- go or proceed from one point to another
- arouse sympathy or compassion in
- move so as to change position, perform a nontranslational motion
- change residence, affiliation, or place of employment
- be in a state of action
- follow a procedure or take a course
- (game) a player's turn to take some action permitted by the rules of the game
- cause to move or shift into a new position or place, both in a concrete and in an abstract sense
- change location; move, travel, or proceed, also metaphorically
- keep engaged
- perform as expected when applied
- perform a movement in military or naval tactics in order to secure an advantage in attack or defense
- direct or control; projects, businesses, etc.
- handle and cause to function
- perform surgery on
- a loud bombastic declamation expressed with strong emotion
- talk in a noisy, excited, or declamatory manner
- be diffused
- flee; take to one's heels; cut and run
- include as the content; broadcast or publicize
- a race between candidates for elective office
- run, stand, or compete for an office or a position
- keep company
- move along, of liquids
- continue to exist
- perform as expected when applied
- pursue for food or sport (as of wild animals)
- cause something to pass or lead somewhere
- stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
- have a tendency or disposition to do or be something; be inclined
- progress by being changed
- direct or control; projects, businesses, etc.
- compete in a race
- a row of unravelled stitches
- change or be different within limits
- a small stream
- a score in baseball made by a runner touching all four bases safely
- the act of running; traveling on foot at a fast pace
- a regular trip
- a short trip
- an unbroken chronological sequence
- the production achieved during a continuous period of operation (of a machine or factory etc.)
- unrestricted freedom to use
- the continuous period of time during which something (a machine or a factory) operates or continues in operation
- an unbroken series of events
- the act of testing something
- a race run on foot
- cause an animal to move fast
- move about freely and without restraint, or act as if running around in an uncontrolled way
- deal in illegally, such as arms or liquor
- set animals loose to graze
- make without a miss
- carry out a process or program, as on a computer or a machine
- occur persistently
- extend or continue for a certain period of time
- be affected by; be subjected to
- have a particular form
- become undone
- cause to perform
- change from one state to another
- be operating, running or functioning
- carry out
- cover by running; run a certain distance
- move fast by using one's feet, with one foot off the ground at any given time
- travel rapidly, by any (unspecified) means
- run with the ball; in such sports as football
- sail before the wind
- come unraveled or undone as if by snagging
- reduce or cause to be reduced from a solid to a liquid state, usually by heating
- (American football) a play in which a player attempts to carry the ball through or past the opposing team
- cause to emit recorded audio or video
- pass over, across, or through
- cry or whine with snuffling
- the act of breathing heavily through the nose (as when the nose is congested)
- whining in a tearful manner
- snuff up mucus through the nose
- a rapid active commotion
- to begin moving
- a prominent or sensational but short-lived news event
- move an implement through
- summon into action or bring into existence, often as if by magic
- causing to move repeatedly from side to side
- move from side to side
- accompany or escort
- (baseball) an advance to first base by a batter who receives four balls
- the act of traveling by foot
- the act of walking somewhere
- a slow gait of a horse in which two feet are always on the ground
- a path set aside for walking
- manner of walking
- careers in general
- be or act in association with
- live or behave in a specified manner
- obtain a base on balls
- give a base on balls to
- take a walk; go for a walk; walk for pleasure
- use one's feet to advance; advance by steps
- make walk
- traverse or cover by walking
- walk at a pace
- cry loudly, as of animals
- a very loud utterance (like the sound of an animal)
- make a loud noise, as of animal
- shout loudly and without restraint
- United States author (born in Canada) whose novels influenced American literature after World War II (1915-2005)
- bring up a topic for discussion
- people who have been introduced to the mysteries of some field or activity
- take the lead or initiative in; participate in the development of
- someone who has been admitted to membership in a scholarly field
- someone new to a field or activity
- bring into being
- accept people into an exclusive society or group, usually with some rite
- set in motion, start an event or prepare the way for
- shed tears because of sadness, rage, or pain
- چلانا جیسے گاڑی میں بٹھا کر لے جانا
- گھوڑے کا نکالنا یا درست کرنا
What is the synonym of chalaana?
Synonym of word chalaana are حرکت دینا, اکسانا, ہلانا, ڈلانا, چلانا, ہلکورنا, جھکولنا, ہلچل کرنا, اشتعال بازی کرنا, سوچ وبچار
What are the idioms related to chalaana?
Here are the idioms that are related to the word chalaana.
- There is no dog so sad but he will wag his tail
- To operate
- What wind blew you hither
- March past
- Rogue march