Pechanna - پہچاننا meanings in English
Pechanna - پہچاننا meanings in English are discriminate, recognizee, cognizee, intromits, recognize, recognizably, hognosed skunk, understand, know, indicate, identify, experience, discern, detect, ken, diagnose, distinguish, recognizing Pechanna - پہچاننا in English. More meanings of pechanna - پہچاننا, it's definitions, example sentences, related words, idioms and quotations.
discriminate recognizee cognizee intromits recognize recognizably hognosed skunk understand know indicate identify experience discern detect ken diagnose distinguish recognizing
Pechanna - پہچاننا Definitions
Please find 53 English and definitions related to the word Pechanna - پہچاننا.
- (verb) : treat differently on the basis of sex or race
- (verb) : recognize or perceive the difference
- (verb) : distinguish
- (adjective) : marked by the ability to see or make fine distinctions
- (verb) : determine or distinguish the nature of a problem or an illness through a diagnostic analysis
- (verb) : subject to a medical analysis
- (verb) : consider to be equal or the same
- (verb) : recognize as being; establish the identity of someone or something
- (verb) : consider (oneself) as similar to somebody else
- (verb) : conceive of as united or associated
- (verb) : give the name or identifying characteristics of; refer to by name or some other identifying characteristic property
- (noun) : the range of vision
- (noun) : range of what one can know or understand
- (verb) : accept (someone) to be what is claimed or accept his power and authority
- (verb) : have sexual intercourse with
- (verb) : be cognizant or aware of a fact or a specific piece of information; possess knowledge or information about
- (verb) : be familiar or acquainted with a person or an object
- (verb) : be aware of the truth of something; have a belief or faith in something; regard as true beyond any doubt
- (verb) : know how to do or perform something
- (verb) : have fixed in the mind
- (verb) : have firsthand knowledge of states, situations, emotions, or sensations
- (verb) : perceive as familiar
- (verb) : be able to distinguish, recognize as being different
- (verb) : know the nature or character of
- (noun) : the fact of being aware of information that is known to few people
- (verb) : discover or determine the existence, presence, or fact of
- (verb) : have firsthand knowledge of states, situations, emotions, or sensations
- (noun) : the accumulation of knowledge or skill that results from direct participation in events or activities
- (noun) : the content of direct observation or participation in an event
- (noun) : an event as apprehended
- (verb) : undergo
- (verb) : undergo an emotional sensation or be in a particular state of mind
- (verb) : go through (mental or physical states or experiences)
- (verb) : undergo or live through a difficult experience
- (noun) : large naked-muzzled skunk with white back and tail; of southwestern North America and Mexico
- (verb) : give evidence of
- (verb) : indicate a place, direction, person, or thing; either spatially or figuratively
- (verb) : be a signal for or a symptom of
- (verb) : to state or express briefly
- (adverb) : to a recognizable degree
- (verb) : grant credentials to
- (verb) : accept (someone) to be what is claimed or accept his power and authority
- (verb) : express obligation, thanks, or gratitude for
- (verb) : express greetings upon meeting someone
- (verb) : be fully aware or cognizant of
- (verb) : perceive to be the same
- (verb) : show approval or appreciation of
- (verb) : exhibit recognition for (an antigen or a substrate)
- (verb) : perceive (an idea or situation) mentally
- (verb) : be understanding of
- (verb) : make sense of a language
- (verb) : believe to be the case
- (verb) : know and comprehend the nature or meaning of
More words related to the meanings of Pechanna - پہچاننا
More words from English related to Pechanna - پہچاننا
View an extensive list of words below that are related to the meanings of the word Pechanna - پہچاننا meanings in English in English.
abstractcutoffdiscard disconnectdisembodydisemploy disengagedisjoin dispart disseverdistractdistingusishsheardetachdislocatedisplacedistinguishdivorce insulateisolateretiresecludesegregateseparatesequesterseverunfastenunfixaltercatedesalinatedisassociationdissociatedissociationseptateseptationseveringalginatedisseatingportioningseparatingseptuplingalacrifyinsociateobolizesegregatingdiscriminatedissipatedismemberdesacralizedesalinization ... disarticulatediscorporatedisincarnatedisinclinedisinvestindividuatedesaltingdisanchordismaskdisquietendisseizedisseizingparpingsegmentingdisacidifydisanimatingdisannexdisassimilatedisassociatingdisconsecratedisengagingdisincarceratedisinhumedisintricatedisinvigoratedisoxidatedisseizeedissheathedissocializedisspiritcleaveset asidewinnowfork outdetachesdetuncateseptentrionateabatessubtractdescrivingdivagatingdiffractingdiscrivedisincorporatingdivaricatingaccommodateidentifyidentifiesattuneaccordcorrespondquadratetallyaccountfancycomprehenddeemexpostulategraspunderstandviewperceptiblydeemingperceivingperceivancekenknowlearnjudgewiswistacquestforeknewjnanaacquirecreditsfindgainobtainprocureachievegetovertakereceiverecognisesecureundergowrenchaffirmevidencedeclaredemonstratedisclose indicatenotifyspeakexpressingaffixappendblendcementcompareconnectekeembodyimmiximplicatejoinjointjumblelinklikenlumpminglemixtacktemperadjoincollateinductintermingleintermixintroducekneadmeldinviscatingagreeblenchappraisediagnoseestimateevaluateimpersonatedeintegrateprognosticatingapprehendcapturecatchentrammel grabgripholdnailsniggletakeclutchcopdetectdiscovergripehaulhitchpreventseizetweezeclutchinggrabbinggrabblingwinchingapprisegesticulationteachexpressinformrelatesaytellunbosomunfoldascribingtellaringbrilliantdifferenteminenthonouredpalmarypre eminentsignalstatesmenacechosencrackingdiagnosticdistinct distinguishedegregiousexaltedloftymarkednotableobservableoutstandingprominentprosilientsalientdifferentiateddenominativelyindistinguishedsupereminentcomprehensionperceptioncommon sensediscernmentgumptionjudgementsavvyunderstandingwitcognizeperceivecognisingcognizingilliberalizingownderecognizeidentifyingrevegetatecriteriondiscriminationdistinctnessidentificationacquaintanceexperienceidentityindicationknowledgemarkrecognitionsigntokenhallmarksintituleintitulescognatenesshognosesnakeintinctivityirrecognitionrecognitoryrecognizabilityrecognizationrecognoscedifferentiatediscerndiversifymodifydisjunedifferencingdistinguishingindistinguishingfeel ascertainmaking knownascertainingdivulgemanifestbewraygive awaypropalerevealdisplayenunciateexplainprofesspublishshowuncloseunearthmanifestingrevendicateclear sightednessinsightprudencebestialisebestialityinsightfulnessinsightsenquiryestimationevaluationlibrationscrutinytentativetrialverificationfastness maturationmaturenessmaturitysteadinessconcotiondurabilityindelibilityinveteracyripenesssteadfastnessstrengthherenessmaturationalmaturementsolemnizationmatinessmaturablematuratesmaturesmaturingmaturitiessolemnnessaldermanityfirmitygenerategesturedenotehintimplyinsinuatementionpinkpinpointsignifytipwinkpointingallusiveclue inpointing outpromptingbeckoningdenotatingdenotinggestatinggesturinghintinginditingnoshingpromulgingindoctrinatinggeekkenningmotiveobservanceopticalexpectationeyesightglancelooksightsquintvisionuplookviewinessavisionglasedlabelquoterecordpoint upemblematizingclose attentioncareconsiderationcustodyintentregardsight gagsightedgazementgazersightlinevisceratessightfulnessnoticesembleseemlecturelessonhomeworksutorialtutorialstentativenessexperimentforetastegiftprooftestexperimentationexperrectionextracttracetrackderacinationtraceablytraceriesderacinatingencumbermentinaquationingravidateinracinate
Idioms related to the meaning of Pechanna - پہچاننا
What are the meanings of Pechanna - پہچاننا in English?
Meanings of the word Pechanna - پہچاننا in English are discriminate, distinguish, diagnose, identify, ken, know, detect, discern, experience, hognosed skunk, indicate, recognizably, recognize, understand, intromits, cognizee, recognizee and recognizing. To understand how would you translate the word Pechanna - پہچاننا in English, you can take help from words closely related to Pechanna - پہچاننا or it’s English translations. Some of these words can also be considered Pechanna - پہچاننا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Pechanna - پہچاننا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Pechanna - پہچاننا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Pechanna - پہچاننا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Pechanna - پہچاننا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by pechanna?
Meanings of pechanna are discriminate, distinguish, diagnose, identify, ken, know, detect, discern, experience, hognosed skunk, indicate, recognizably, recognize, understand, intromits, cognizee, recognizee and recognizing
Whats the definition of pechanna?
Definition of the pechanna are
- treat differently on the basis of sex or race
- recognize or perceive the difference
- distinguish
- marked by the ability to see or make fine distinctions
- determine or distinguish the nature of a problem or an illness through a diagnostic analysis
- subject to a medical analysis
- consider to be equal or the same
- recognize as being; establish the identity of someone or something
- consider (oneself) as similar to somebody else
- conceive of as united or associated
- give the name or identifying characteristics of; refer to by name or some other identifying characteristic property
- the range of vision
- range of what one can know or understand
- accept (someone) to be what is claimed or accept his power and authority
- have sexual intercourse with
- be cognizant or aware of a fact or a specific piece of information; possess knowledge or information about
- be familiar or acquainted with a person or an object
- be aware of the truth of something; have a belief or faith in something; regard as true beyond any doubt
- know how to do or perform something
- have fixed in the mind
- have firsthand knowledge of states, situations, emotions, or sensations
- perceive as familiar
- be able to distinguish, recognize as being different
- know the nature or character of
- the fact of being aware of information that is known to few people
- discover or determine the existence, presence, or fact of
- have firsthand knowledge of states, situations, emotions, or sensations
- the accumulation of knowledge or skill that results from direct participation in events or activities
- the content of direct observation or participation in an event
- an event as apprehended
- undergo
- undergo an emotional sensation or be in a particular state of mind
- go through (mental or physical states or experiences)
- undergo or live through a difficult experience
- large naked-muzzled skunk with white back and tail; of southwestern North America and Mexico
- give evidence of
- indicate a place, direction, person, or thing; either spatially or figuratively
- be a signal for or a symptom of
- to state or express briefly
- to a recognizable degree
- grant credentials to
- accept (someone) to be what is claimed or accept his power and authority
- express obligation, thanks, or gratitude for
- express greetings upon meeting someone
- be fully aware or cognizant of
- perceive to be the same
- show approval or appreciation of
- exhibit recognition for (an antigen or a substrate)
- perceive (an idea or situation) mentally
- be understanding of
- make sense of a language
- believe to be the case
- know and comprehend the nature or meaning of
What is the synonym of pechanna?
Synonym of word pechanna are پہچاننا, فرق دیکھنا, جدا کرنا, علیحدہ کرنا, فرق کرنا, تفریق کرنا, تمیز کرنا, ممتاز, جاننا, چینھنا
What are the idioms related to pechanna?
Here are the idioms that are related to the word pechanna.
- Experience without learning is better than learning without experience
- He that would right understand a man must read his whole story
- Let every man talk of what he understand
- Nothing is bad if we understand it right
- That is not good language that all understand not