dushman - دشمن meanings in English
dushman - دشمن meanings in English are enemy, foes, foemen, foeman, inimical, fiend, adversary, rival, opposite, hostile, foe, felonious, eneid dushman - دشمن in English. More meanings of dushman - دشمن, it's definitions, example sentences, related words, idioms and quotations.
enemy foes foemen foeman inimical fiend adversary rival opposite hostile foe felonious eneid
dushman - دشمن Definitions
Please find 29 English and definitions related to the word dushman - دشمن.
- (noun) : any hostile group of people
- (noun) : an opposing military force
- (noun) : a personal enemy
- (adjective satellite) : involving or being or having the nature of a crime
- (noun) : a person motivated by irrational enthusiasm (as for a cause)
- (noun) : a cruel wicked and inhuman person
- (noun) : an evil supernatural being
- (noun) : a personal enemy
- (adjective satellite) : very unfavorable to life or growth
- (adjective) : characterized by enmity or ill will
- (adjective satellite) : impossible to bring into friendly accord
- (adjective) : not belonging to your own country's forces or those of an ally
- (noun) : troops belonging to the enemy's military forces
- (adjective satellite) : unsolicited and resisted by the management of the target company (used of attempts to buy or take control of a business)
- (noun) : a relation of direct opposition
- (noun) : something inverted in sequence or character or effect
- (adjective) : of leaves etc; growing in pairs on either side of a stem
- (adjective satellite) : altogether different in nature or quality or significance
- (adjective satellite) : the other one of a complementary pair
- (adjective satellite) : being directly across from each other; facing
- (adjective satellite) : moving or facing away from each other
- (adjective satellite) : characterized by opposite extremes; completely opposed
- (adverb) : directly facing each other
- (noun) : a word that expresses a meaning opposed to the meaning of another word, in which case the two words are antonyms of each other
- (noun) : the contestant you hope to defeat
- (verb) : be equal to in quality or ability
- (verb) : be the rival of, be in competition with
- (noun) : someone who offers opposition
- (adjective satellite) : not friendly
More words related to the meanings of dushman - دشمن
More words from English related to dushman - دشمن
View an extensive list of words below that are related to the meanings of the word dushman - دشمن meanings in English in English.
abandonedbadcorruptcorruptedevilfeloniousgracelessillimpairedmuddynastynaughtprostituderamshacklecontaminateddamageddefectiveflawedkaputmucuousobsceneoffensiveout of orderperversepollutedputidrottenruinedspoiledunchasteuncleanwickedwonkywretchwretchedwryerodeperversivespoilablespoilingworsenedbadasseddefacedimpairingirruptedirruptingmalaxatedmalleatesmelanousmishapped ... perigealscrewedspoilfulspoomingspooredspooringwarstwreakfulwreckfulwrickedwrokenmiswroughtperiledabominabledispleasingdisserviceable flagitiousforbidding immoralmawkishmischievousnefariousodiousindecentinfamousinsultablejadishlamentablenaughtyopprobriousunbecomingbaddybadiousabreastceaselesscontinuouscoequalequableequalequallyflat liketantamountadjoiningalikeconstantlycontinuallyequivalent evenidenticallevelnextoppositequitsstraightuniformup toequablyequalisedequalisersequalizedequalizersequalizesequalledequallingequalsleveredepanthousaffectionfiendgeniuslemuresmanesmisacceptationphantomphantomsspecteraffectationfondnessghostlovespookphantomyhaunceagainstversuscontradictorycontraryin opposition toagainstandcontrarietyfrowardnessobduracyobduratenessopinionativenesswaywardnessantilogyantithesiscontrarinessdournesseffronteryenmityinflexibilityinverseobstinacyoppositionpersistencepertinacityantitheticantitumorantitussivestub outstubbinessanticousantistaticantitheiststubbierstubbieststubblesstubblierstubblieststubbornedstubbornsanticontagiousantitropousstibbornstubbednessarchfiendimpdemondeucedevilmiscreantold nicksatandemonolatrydevilryshaitanshaytanthe devildemonrydevildomdevileddevilessdeviletdevilingdevilleddevilsdevisersfreakedfreaksghostliershaitansavidiousdemoniandiadelphousbanefulhurtfulmaleficentwastefulbalefuldeleteriousharmfulinimicalinjurerinjuriousinsanitarymalignmalignantmephiticnocentnocuousnoisomenoxiousarboricalhazardablehazeshaziermalariousmalvaceoustellurousperniciousbrambleenemy foestrangerbarriebeeryberryberaybarrybubodiabolicdisimpiouslewdcaitiffcussedearth bredflashmobbishpiggishribaldabjectbasecadcaddishdepravedfootyignoblemaliciousmeanniggardpusillanimoussnotuglyunderbredvilevulgarcontraconversely oppositelyabout faceantipodalcontrasto the contrarycontraindicateddissimilar hostileobjectoropponentoppugnantvariousadversaryadverseanticonfrontationaldissenteropposedvillainadversativeantagonistantagonisticanticanceropposableopposeradverserantlikeopposelessoppositesadversariousantagonisticalantagonizedanticorobversantoppositionistoppositipetalousfalsebogusdishonestfallowfaultyfraudulentphoneyspitefulspuriouscorruptiveguiltymorbidrakishstagnantviciouscompetitoremulousjeerermatchrivalviercontestantnemesisrivalrouspredialrivalessrivalisedrivalizedrivalledrivallessrivuletsbivalvousrivosecomparablecontendercollateralcopeobsoleteoutcasttrashyvaluelessabortivedecrepitgood for nothingineptinoperableinoperativenon effectivenugatorypicayuneunserviceableuselessworthlesszerodisabusedineffableinefficientdefunctivedefuseddesilvereddisallieddisjectsdislimneddismodeddisowneddissipableinaidableuncapableunfabledvilestdestinablediscordabledisfurnisheddispeeddisprofitabledissimulerinaffableincorruptiveinopulentinsuitableunitableunsucceedabledozensdozenthsmatchableconversematchingplausiveobvolutedversalcompunctiousheremiticaloblocutorerrant erraticmisbelievermisguidedrunagateaberrantastraydeludeddeviouserringlornlostremotereprobatewackywhackydeviantstrayermisgivedmislearedmisledmislivemislivedmislivingmisluckedmispleadedperversedperversedlymalignergrudgemalignancypiquegallmalicerancourspitevengeancefelonfelonsmutineermutinousinsurgentinsurrectionistrebelrebelliousinsurgentsrebelledrebellerrebellersrebelsghastlyhobgoblinapparitionbogeyfetchrevenantghoostghostedghostiestghostingghostsghostypredilectpythonbugabooforwardyonderafrontaheadbeforefacing in frontfrontallyout frontfrontagesfaciendpestderogatorydetrimentalscathingharmotomecounterproductivedestructivedamagingdamascenedamnabledamnatorydamningdetribalisationdetribalizationdetribalizedetrimentallydisadvantageousharmfulnesslossyperniciousnessdamageabledamaskingdamnifyinglossierdamnabilitydamnablenessdamnificdetrimentalnessindemnifyinglossfulvulnificbawdymalefactorpeerobverselyawrybackcrookedinverselyleftreversewronginvertasereverselyreversiblyupsideupside downinversedinversinginversionsinversiveinvertedlyrenverserenversedsubversedsubvertedprosecutoraccuserclaimantcomplainantlitigantplaintiffplainchantplaintiveplaintiffsplainantface to facevis a visoppositiveoverturninexactretrogradereversalreversionreversreversedreversiveultinversesobversesoverturnsreversalsreversedlyreversesreversingreversingsreversisreverselessvenomouspoisonousviperousvitriolicchancroustoxaemiatoxemiatoxictoxicanttoxicitytoxicognathtoxicologicaltoxicologypoisonablesaxicavoustoxaemictoxemictoxicaltoxicallytoxicantstoxicationtoxiphobiatoxophilytoxicomaniatoxineadversarialdevilishfiendishclashconflictconflictingcontradictiondiscordantinconsequentcountercombative
Idioms with the word dushman - دشمن in it
Idioms related to the meaning of dushman - دشمن
What are the meanings of dushman - دشمن in English?
Meanings of the word dushman - دشمن in English are enemy, felonious, fiend, foe, hostile, opposite, rival, adversary, foeman, inimical, foemen, foes and eneid. To understand how would you translate the word dushman - دشمن in English, you can take help from words closely related to dushman - دشمن or it’s English translations. Some of these words can also be considered dushman - دشمن synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word dushman - دشمن. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use dushman - دشمن in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say dushman - دشمن in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of dushman - دشمن with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by دشمن?
Meanings of دشمن are enemy, felonious, fiend, foe, hostile, opposite, rival, adversary, foeman, inimical, foemen, foes and eneid
Whats the definition of دشمن?
Definition of the دشمن are
- any hostile group of people
- an opposing military force
- a personal enemy
- involving or being or having the nature of a crime
- a person motivated by irrational enthusiasm (as for a cause)
- a cruel wicked and inhuman person
- an evil supernatural being
- a personal enemy
- very unfavorable to life or growth
- characterized by enmity or ill will
- impossible to bring into friendly accord
- not belonging to your own country's forces or those of an ally
- troops belonging to the enemy's military forces
- unsolicited and resisted by the management of the target company (used of attempts to buy or take control of a business)
- a relation of direct opposition
- something inverted in sequence or character or effect
- of leaves etc; growing in pairs on either side of a stem
- altogether different in nature or quality or significance
- the other one of a complementary pair
- being directly across from each other; facing
- moving or facing away from each other
- characterized by opposite extremes; completely opposed
- directly facing each other
- a word that expresses a meaning opposed to the meaning of another word, in which case the two words are antonyms of each other
- the contestant you hope to defeat
- be equal to in quality or ability
- be the rival of, be in competition with
- someone who offers opposition
- not friendly
What is the synonym of دشمن?
Synonym of word دشمن are بیری, شترو, درجن, رپو, دشمن, حریف, مخالف, عدو, دُشمن, غنیم
What are the idioms with the word دشمن?
Here are the idioms with the word دشمن in them.
- A little debt makes a debter but a great one an enemy
- A little debt makes a debter but a great one an enemy
- A traitor is ill company
- Adversity is the best judge of a friend and a foe
- An open enemy is better than a false friends
What are the idioms related to دشمن?
Here are the idioms that are related to the word دشمن.
- At table it becomes no one to be hostile
- Lubber fiend
- Be opposite with
- Opposite number
- Do not attempt to rival the powerful