Thook - تھوک meanings in English

Thook - تھوک meanings in English are batch, salivary, salivation, saligots, salivas, salivates, spats, telesale, thowel, thoric, wholesale, sputum, spittle, drivel, spit, spwal, tenure, bulk, heap, lot, mass, saliva Thook - تھوک in English. More meanings of thook - تھوک, it's definitions, example sentences, related words, idioms and quotations.

batch salivary salivation saligots salivas salivates spats telesale thowel thoric wholesale sputum spittle drivel spit spwal tenure bulk heap lot mass saliva spittle

Install chrome extension

Thook - تھوک Definitions

Please find 56 English and 1 Urdu definitions related to the word Thook - تھوک.

  • (noun) : a collection of things or persons to be handled together
  • (noun) : all the loaves of bread baked at the same time
  • (verb) : batch together; assemble or process as a batch
  • (noun) : (often followed by of') a large number or amount or extent
  • (noun) : the property possessed by a large mass
  • (noun) : the property of something that is great in magnitude
  • (noun) : the property resulting from being or relating to the greater in number of two parts; the main part
  • (verb) : stick out or up
  • (verb) : cause to bulge or swell outwards
  • (noun) : a worthless message
  • (noun) : the property of something that is great in magnitude
  • (noun) : (Roman Catholic Church and Protestant Churches) the celebration of the Eucharist
  • (noun) : the property of a body that causes it to have weight in a gravitational field
  • (noun) : a sequence of prayers constituting the Christian eucharistic rite
  • (noun) : a musical setting for a Mass
  • (noun) : an ill-structured collection of similar things (objects or people)
  • (noun) : a body of matter without definite shape
  • (noun) : the common people generally
  • (verb) : join together into a mass or collect or form a mass
  • (adjective satellite) : formed of separate units gathered into a mass or whole
  • (noun) : (often followed by of') a large number or amount or extent
  • (noun) : a clear liquid secreted into the mouth by the salivary glands and mucous glands of the mouth; moistens the mouth and starts the digestion of starches
  • (noun) : a clear liquid secreted into the mouth by the salivary glands and mucous glands of the mouth; moistens the mouth and starts the digestion of starches
  • (noun) : the act of spitting (forcefully expelling saliva)
  • (noun) : a skewer for holding meat over a fire
  • (verb) : utter with anger or contempt
  • (verb) : expel or eject (saliva or phlegm or sputum) from the mouth
  • (verb) : rain gently
  • (verb) : drive a skewer through
  • (noun) : the right to hold property; part of an ancient hierarchical system of holding lands
  • (noun) : the term during which some position is held
  • (verb) : give life-time employment to
  • (noun) : a car that is old and unreliable
  • (noun) : a collection of objects laid on top of each other
  • (verb) : arrange in stacks
  • (verb) : fill to overflow
  • (verb) : bestow in large quantities
  • (noun) : (often followed by of') a large number or amount or extent
  • (noun) : an unofficial association of people or groups
  • (noun) : any collection in its entirety
  • (noun) : your overall circumstances or condition in life (including everything that happens to you)
  • (verb) : administer or bestow, as in small portions
  • (noun) : anything (straws or pebbles etc.) taken or chosen at random
  • (noun) : a parcel of land having fixed boundaries
  • (noun) : (often followed by of') a large number or amount or extent
  • (noun) : (Old Testament) nephew of Abraham; God destroyed Sodom and Gomorrah but chose to spare Lot and his family who were told to flee without looking back at the destruction
  • (verb) : divide into lots, as of land, for example
  • (adjective) : of or relating to saliva
  • (noun) : the secretion of saliva
  • (noun) : a clear liquid secreted into the mouth by the salivary glands and mucous glands of the mouth; moistens the mouth and starts the digestion of starches
  • (noun) : expectorated matter; saliva mixed with discharges from the respiratory passages; in ancient and medieval physiology it was believed to cause sluggishness
  • (adjective satellite) : ignoring distinctions
  • (adverb) : on a large scale without careful discrimination
  • (verb) : sell in large quantities
  • (adverb) : at a wholesale price
  • (noun) : the selling of goods to merchants; usually in large quantities for resale to consumers
  • بَيَک وَقَت پَکائی گَئی مِقدار

More words related to the meanings of Thook - تھوک

Batchاکٹھا کرنا ikattha karna اکٹھا کرنا ikttha karna گھان ghaan تھوک thok تھوک thuuk تھوک Thook جتھا jatha جتھا Juttha پُور Poor جتھہ jattha پور por پور puur پور Pore گتھی بنانا gatthi banaana
Bulkکثرت kasrat ڈھیر dheyr ڈھیر Dhair تھوک thok تھوک thuuk تھوک Thook جسامت jasaamat جسامت Jasamat ڈیل diil ڈیل Deal حجم hajam زیادہ مقدار ضخامت zakhaamat ضخامت Sakhamat
Drivelتھوک thok تھوک thuuk تھوک Thook رال raal بکواس کرنا bak waas karna بکواس کرنا bakwaas karna لار Laar لعاب دہن رال ٹپکنا یا بہنا لعاب جاری رہنا بچے کی رال بہنا bachchey ki raal baehna بدھو پن دکھانا buddhu pan dikhaana
Massڈھیر dheyr ڈھیر Dhair تودہ Todah انبار anbaar ڈلا dala ڈلا Dalla تھوک thok تھوک thuuk تھوک Thook مقدار miqdaar مقدار meqdaar مقدار Miqdar بھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird اژدہام azdahaam اژدہام az dahaam پشتارا pushtaara
Salivaتھوک thok تھوک thuuk تھوک Thook رال raal لب lab لب lub لب Laab لعاب داری
Spitتھوک thok تھوک thuuk تھوک Thook رال raal لعاب دہن سیخ siikh پرونا pirona پرونا priona اگلنا ugalna
Spwalتھوک thok تھوک thuuk تھوک Thook رال raal کھنکار Khunkaar لار Laar
Tenureعلاقہ elaaqah علاقہ Elaqa علاقہ Ilaqa پٹی patti تعلقہ talluqah تعلقہ taalluqah تھوک thok تھوک thuuk تھوک Thook قبضہ qabzah قبضہ Qabza کاشت kaasht مدت muddat ملکیت milkiyat ملکیت Malkiyat حق ملکیت حق لگان داری میعاد meyaad میعاد maiaad میعاد Meeaad میعاد Miyaad
Heapڈھیر dheyr ڈھیر Dhair انبار anbaar گنج ganj تھوک thok تھوک thuuk تھوک Thook ڈھیر لگانا dheyr lagaana پشتارا pushtaara پشتارا باندھنا pushtaara baandhna
Lotتھوک thok تھوک thuuk تھوک Thook حصہ hissah حصہ Hissa .Hisa قسمت qismat طالع taale طالع Taaley حق haq حق Huq نصیب nasiib نصیب Naseeb
Salivaryتھوک thok تھوک thuuk تھوک Thook
Salivationتھوک thok تھوک thuuk تھوک Thook
Spittleتھوک thok تھوک thuuk تھوک Thook رال raal کف kaf کف Kuff
Sputumتھوک thok تھوک thuuk تھوک Thook
Wholesaleتھوک thok تھوک thuuk تھوک Thook
Saligotsتھوک thok تھوک thuuk تھوک Thook
Salivasتھوک thok تھوک thuuk تھوک Thook
Salivatesتھوک thok تھوک thuuk تھوک Thook
Spatsتھوک thok تھوک thuuk تھوک Thook
Telesaleتھوک thok تھوک thuuk تھوک Thook
Thowelتھوک thok تھوک thuuk تھوک Thook
Thoricتھوک thok تھوک thuuk تھوک Thook

More words from English related to Thook - تھوک

View an extensive list of words below that are related to the meanings of the word Thook - تھوک meanings in English in English.

abundanceflushfrequencyglutmuchmultiplicitynumerousnessopulenceoverstockpluralityprofusenessrampancyrichnessvastnessaffluencebulkexcessexuberanceinfestationinfluxlargenesslavishmuchnessmultitudenimietynumerosityoutpouringplentypleromaplethoraoftennesspolyvalenceaboundsabundancesabundancyfrequentagefrequentationmulierosityseveralityaccumulationagglomerationbankcongeriescongregationdrift massmucuspileabundantbing ...

What are the meanings of Thook - تھوک in English?

Meanings of the word Thook - تھوک in English are batch, bulk, drivel, mass, saliva, spit, spwal, tenure, heap, lot, salivary, salivation, spittle, sputum, wholesale, saligots, salivas, salivates, spats, telesale, thowel and thoric. To understand how would you translate the word Thook - تھوک in English, you can take help from words closely related to Thook - تھوک or it’s English translations. Some of these words can also be considered Thook - تھوک synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Thook - تھوک. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Thook - تھوک in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.

We have tried our level best to provide you as much detail on how to say Thook - تھوک in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Thook - تھوک with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.

Frequently Asked Questions (FAQ)

What do you mean by thook?

Meanings of thook are batch, bulk, drivel, mass, saliva, spit, spwal, tenure, heap, lot, salivary, salivation, spittle, sputum, wholesale, saligots, salivas, salivates, spats, telesale, thowel and thoric

Whats the definition of thook?

Definition of the thook are

  • a collection of things or persons to be handled together
  • all the loaves of bread baked at the same time
  • batch together; assemble or process as a batch
  • (often followed by of') a large number or amount or extent
  • the property possessed by a large mass
  • the property of something that is great in magnitude
  • the property resulting from being or relating to the greater in number of two parts; the main part
  • stick out or up
  • cause to bulge or swell outwards
  • a worthless message
  • the property of something that is great in magnitude
  • (Roman Catholic Church and Protestant Churches) the celebration of the Eucharist
  • the property of a body that causes it to have weight in a gravitational field
  • a sequence of prayers constituting the Christian eucharistic rite
  • a musical setting for a Mass
  • an ill-structured collection of similar things (objects or people)
  • a body of matter without definite shape
  • the common people generally
  • join together into a mass or collect or form a mass
  • formed of separate units gathered into a mass or whole
  • (often followed by of') a large number or amount or extent
  • a clear liquid secreted into the mouth by the salivary glands and mucous glands of the mouth; moistens the mouth and starts the digestion of starches
  • a clear liquid secreted into the mouth by the salivary glands and mucous glands of the mouth; moistens the mouth and starts the digestion of starches
  • the act of spitting (forcefully expelling saliva)
  • a skewer for holding meat over a fire
  • utter with anger or contempt
  • expel or eject (saliva or phlegm or sputum) from the mouth
  • rain gently
  • drive a skewer through
  • the right to hold property; part of an ancient hierarchical system of holding lands
  • the term during which some position is held
  • give life-time employment to
  • a car that is old and unreliable
  • a collection of objects laid on top of each other
  • arrange in stacks
  • fill to overflow
  • bestow in large quantities
  • (often followed by of') a large number or amount or extent
  • an unofficial association of people or groups
  • any collection in its entirety
  • your overall circumstances or condition in life (including everything that happens to you)
  • administer or bestow, as in small portions
  • anything (straws or pebbles etc.) taken or chosen at random
  • a parcel of land having fixed boundaries
  • (often followed by of') a large number or amount or extent
  • (Old Testament) nephew of Abraham; God destroyed Sodom and Gomorrah but chose to spare Lot and his family who were told to flee without looking back at the destruction
  • divide into lots, as of land, for example
  • of or relating to saliva
  • the secretion of saliva
  • a clear liquid secreted into the mouth by the salivary glands and mucous glands of the mouth; moistens the mouth and starts the digestion of starches
  • expectorated matter; saliva mixed with discharges from the respiratory passages; in ancient and medieval physiology it was believed to cause sluggishness
  • ignoring distinctions
  • on a large scale without careful discrimination
  • sell in large quantities
  • at a wholesale price
  • the selling of goods to merchants; usually in large quantities for resale to consumers
  • بَيَک وَقَت پَکائی گَئی مِقدار

What is the synonym of thook?

Synonym of word thook are اکٹھا کرنا, گھان, تھوک, جتھا, پُور, جتھہ, پور, گتھی بنانا, کثرت, ڈھیر

What are the idioms related to thook?

Here are the idioms that are related to the word thook.

  • Pride will spit in pride's face
  • A mind moves the mass
  • Rolling stone gathers no mass
  • Add a little to a little and there will be a great heap
  • Knocktrke all of a heap