کثرت - Kasrat in English
Meanings of کثرت - Kasrat in English are abounds, abundance, abundances. More meanings of کثرت - kasrat in english, it's definitions, example sentences, related words, idioms and quotations.
abundanceflushfrequencyglutmuchmultiplicitynumerousnessopulenceoverstockpluralityprofusenessrampancyrichnessvastnessaffluencebulkexcessexuberanceinfestationinfluxlargenesslavishmuchnessmultitudenimietynumerosityoutpouringplentypleromaplethoraoftennesspolyvalenceaboundsabundancesabundancyfrequentagefrequentationmulierosityseverality
کثرت - Kasrat Definitions
Please find 28 English definitions related to the word کثرت - Kasrat.
- Abundance - (noun) : the property of a more than adequate quantity or supply
- Affluence - (noun) : abundant wealth
- Bulk - (noun) : the property possessed by a large mass
- Excess - (adjective satellite) : more than is needed, desired, or required
- Exuberance - (noun) : overflowing with eager enjoyment or approval
- Flush - (adjective satellite) : having an abundant supply of money or possessions of value
- Frequency - (noun) : the number of observations in a given statistical category
- Infestation - (noun) : a swarm of insects that attack plants
- Influx - (noun) : the process of flowing in
- Largeness - (noun) : the property of having a relatively great size
- Lavish - (verb) : expend profusely; also used with abstract nouns
- Much - (adverb) : very
- Muchness - (noun) : greatness of quantity or measure or extent
- Multiplicity - (noun) : the property of being multiple
- Multitude - (noun) : the common people generally
- Nimiety - (noun) : a quantity much larger than is needed
- Numerosity - (noun) : a large number
- Numerousness - (noun) : a large number
- Oftenness - (noun) : the number of occurrences within a given time period
- Opulence - (noun) : wealth as evidenced by sumptuous living
- Overstock - (verb) : stock excessively
- Plenty - (adverb) : as much as necessary
- Plethora - (noun) : extreme excess
- Plurality - (noun) : a large indefinite number
- Polyvalence - (noun) : (toxicology) the state of being capable of counteracting more than one toxin or antigen or kind of microorganism
- Profuseness - (noun) : the property of being extremely abundant
- Richness - (noun) : abundant wealth
- Vastness - (noun) : unusual largeness in size or extent or number
More words related to the meanings of کثرت - Kasrat
More words from English related to کثرت - Kasrat
View an extensive list of words below that are related to the meanings of the word کثرت - Kasrat in English in English.
abundancerailereeledrilleglutmultiplicityexuberanceinfluxinrushlavishabondancefrequencyfulnessmuchnumerousnessoverstockpluralityprofusenessprofusionaffluencelargenessmuchnessnumerosityplentyplethoraplethorasoverplusrampancynimietyredundanceinfarceabundantfullgrossrichwarblerazesmicklemostmultitudinousnumerousrifeampleconsiderablecopiousmanymassivemultiplicateplentifulunstinted ...
Idioms related to the meaning of کثرت - Kasrat
What are the meanings of کثرت - Kasrat in English?
Meanings of the word کثرت - Kasrat in English are abundance, affluence, bulk, flush, frequency, glut, much, multiplicity, numerousness, opulence, overstock, plurality, profuseness, rampancy, richness, vastness, excess, exuberance, infestation, influx, largeness, lavish, muchness, multitude, nimiety, numerosity, oftenness, outpouring, plenty, plethora, polyvalence, abounds, abundances, abundancy, pleroma, frequentage, frequentation, mulierosity and severality. To understand how would you translate the word کثرت - Kasrat in English, you can take help from words closely related to کثرت - Kasrat or it’s English translations. Some of these words can also be considered کثرت - Kasrat synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word کثرت - Kasrat. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use کثرت - Kasrat in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say کثرت - Kasrat in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of کثرت - Kasrat with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by kasrat?
Meanings of kasrat are abounds, abundance, abundances
What is the synonym of kasrat?
Synonym of word kasrat are ریل, ریل پیل, بہتات, کثرت, افراط, مالا مال, ریز, برکت, فراغت, فراوانی
What are the idioms related to kasrat?
Here are the idioms that are related to the word kasrat.
- ایک ہی مقدار یا قدر کا
- طلب کے مقابلے میں سپلائی زیادہ ہونا
- باتوں کا دھنی کرتب خوار
- دانا آدمی عوام الناس کی تبدیلی پزیر راۓ کی پرواہ نہیں کرتے
- عوام الناس کی راۓ نہ اچھی نہ بُری