دل - Dal in English

Meanings of دل - Dal in English are courage, encouragement, generosity. More meanings of دل - dal in english, it's definitions, example sentences, related words, idioms and quotations.

encouragement hostjeomindcouragegenerosityheartinclinationsoliditysoulswarmthicknesswishlentilspulse

دل - Dal Definitions

Please find 14 English definitions related to the word دل - Dal.

  • Courage -   (noun) : a quality of spirit that enables you to face danger or pain without showing fear
  • Encouragement -   (noun) : the expression of approval and support
  • Generosity -   (noun) : acting generously
  • Heart -   (noun) : a positive feeling of liking
  • Host -   (noun) : a vast multitude
  • Inclination -   (noun) : (physics) the angle that a magnetic needle makes with the plane of the horizon
  • Lentils -   () : considered being the most nutritious and rich of the entire legume family. Lentils are a top source of protein and are high in phosphorous, zinc, iron, calcium, potassium, vitamins A and B complex. Lentils are great when cooked as a curry, as a soup, salad or side dish.
  • Mind -   (noun) : your intention; what you intend to do
  • Pulse -   (noun) : (electronics) a sharp transient wave in the normal electrical state (or a series of such transients)
  • Solidity -   (noun) : the quality of being solid and reliable financially or factually or morally
  • Soul -   (noun) : the human embodiment of something
  • Swarm -   (verb) : move in large numbers
  • Thickness -   (noun) : used of a line or mark
  • Wish -   (verb) : invoke upon

More words related to the meanings of دل - Dal

Courageجراٴت ہمت himmat بہادری bahaaduri دلیری dileyri بے باکی bey baaki بل بوتا bal buuta دل dil دم dam دل گردہ dil gurdah حوصلہ hausalah جسارت jasaarat پتا patta یارا yaara
Encouragementدلاسا dilaasa بڑھاوا barhaawa دل دہی تسلی tasalli ڈھارس dhaaras ترغیب targhiib تحریک taehriik تقویت taqwiyat حوصلہ افزائی دل dil حوصلہ افزائ hausalah afzaa i حمایت hemaayat تائید taa id پشت پناہی pusht panaahi
Generosityعالی ہمتی کشادہ دلی kushadah dili توفیق Tofeeq ہمت himmat سخاوت sakhaawat دریا دلی darya dili دل dil فیضان faezaan فیاضی faiyaazi فراخ دلی faraakh dili جود juud کرم karam مروت murawwat
Hostمہمان دار مہمان نواز mehmaan nawaaz میزبان meyz baan لشکر lashkar فوج fauj دل dil کٹک Katak سینا senna داعی daai صاحب خانہ saahab e khaanah مہمان داری کرنا mehmaan daari karna انبوہ anboh غول ghol ہجوم hujuum سپاہ sipaah
Jeoجیو Geo دل dil قلب qalb ایک دعا
Mindلحاظ کرنا lehaaz karna غور کرنا ghaur karna دھیان کرنا خیال کرنا khayaal karna ماننا maanna ہردا Harda ہیا haya جی jii دل dil من man ضمیر zamiir قلب qalb نفس nafs دماغ dimaagh روح ruuh باطن baatin راغب ہونا مائل ہونا maa el hona میل کرنا آتما aatma عقل aql ہوش hosh جان jaan جگر jigar خاطر khaatir میلان maelaan رائے raa ey دیکھ بھال کرنا deykh bhaal karna نظر رکھنا nazar rakhna
Swarmہجوم کرنا بھیڑ bhiir دل dil غلا ghalla ہجوم hujuum
Wishخواہش کرنا khwaahish karna چاہنا chaahna ارادہ رکھنا eraadah rakhna آرزو aarzu ارمان armaan چاؤ chaa o در خواست dar khwaast دل dil دعا doa ارادہ eraadah فرمائش farmaa ish حسرت hasrat خواہش khwaahish مطلب matlab مراد muraad رغبت raghbat طلب talab طمع tama تمنا tamanna
Heartآتما aatma دل dil فواد fuwaad جگر jigar من man قلب qalb ضمیر zamiir دلق dalaq
Inclinationدل dil لگاؤ lagaa o میلان maelaan مس mas رغبت raghbat رجحان rujhaan رخ rukh افتاد uftaad
Pulseدھڑکن dharkan نبض nabz نبز دال daal
Solidityدل dil متانت mataanat
Soulآتما aatma دل dil جان jaan جی jii جگر jigar قلب qalb روح ruuh
Thicknessدل dil حجم hajam موٹائ motaa i ضخامت zakhaamat
Lentilsدال daal

More words from English related to دل - Dal

View an extensive list of words below that are related to the meanings of the word دل - Dal in English in English.

abilitygenerosityaccedeacquiescecommemorationconcededisbelieve homologatemindvenerateyieldacceptacknowledgeadmitaffordagreeallowassumebelieveconsentholdkeepobeyreceiveregardadmissiveaccededadeemingadhibitadhibitingadhibitsadmixingconceivingconjectobequitatesupputateaccountdeferheedrespectside withenvisionfancyguessimaginesupposethinkcareconsiderfigure ...

Idioms related to the meaning of دل - Dal

Englishاردو
Host in himselfماہر
Since that cannot be done which you wish wish that which can be doneاگر تمہیں وہ چیز نہیں مل سکتی جِس کی تم خواہش کرتے ہو تو ایسی چیز کی خواہش کرو جو تمہیں مل سکتی ہے
When what you wish does not happen wish for what does happenجب تمہاری خواہش پوری نہ ہوتی ہو تو ایسی بات کی خواہش کرو جو پوری ہو سکتی ہو
There needs a long time to know the world pulseدنیا کی اصلیت کا بڑی دیر میں پتہ چلتا ہے
To feel one pulseاحساس کرنا
To feel the pulseکسی کا راز معلوم کرنا
Heart to heartبے تکلف اور آزاد
Courage is often caused by fearمرتا کیا نہ کرتا
Fortune can take away our wealth but not our courageزر جاۓ یا رہے ہمت کبھی نہیں چھوڑنی چاہیئے
God courage breaks ill luckہمت بد قسمتی کو دور کرتی ہے
In doubtful matters courage may do much in desperate patienceمشتبہ معاملات میں دلیری سے بہت کام نکل سکتا ہے لیکن مہلک معاملات میں صبر سے
Luck makes courageخوش قسمتی ہمت کو دوبالا کر دیتی ہے
Money lost nothing lost courage lost much lost honours lost more lostoul lost all lostزر کا نقصان کچھ نقصان نہیں ہمت گئی تو بہت گیا اگر عزت گئی تو اور بھی زیادہ نقصان ہوا لیکن نیک و بد میں تمیز نہ رہی تو سمجھو کہ انسان کے پاس کچھ بھی باقی نہ رہا
Put off your armour and then show your courageگھر سے باہر نکل کر دلیری دکھاوٴ
Take courage younger than thou have been hangedہمت نہ ہارو تم سے چھوٹے بڑی بڑی مصیبتیں جھیل چکے ہیں
The more wit the less courageعقل زیادہ ہمت کم
To screw up one courageہمت کرنا
All wish to know but no one to pay the feeدُنیا میں سب پیسے بغیر کام نکالنا چاہتے ہیں
Better do it than wish it doneآپ کام سو مہا کام
Do unto others what you wish them to do unto youاوروں کے ساتھ ایسا برتاوٴ کرو جیسا تم ان سے چاہتے ہو
View More ...

What are the meanings of دل - Dal in English?

Meanings of the word دل - Dal in English are courage, encouragement, generosity, host, jeo, mind, swarm, wish, heart, inclination, pulse, solidity, soul, thickness and lentils. To understand how would you translate the word دل - Dal in English, you can take help from words closely related to دل - Dal or it’s English translations. Some of these words can also be considered دل - Dal synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word دل - Dal. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use دل - Dal in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.

We have tried our level best to provide you as much detail on how to say دل - Dal in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of دل - Dal with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.

Frequently Asked Questions (FAQ)

What do you mean by dal?

Meanings of dal are courage, encouragement, generosity

What is the synonym of dal?

Synonym of word dal are جراٴت, ہمت, بہادری, دلیری, بے باکی, بل بوتا, دل, دم, دل گردہ, حوصلہ

What are the idioms related to dal?

Here are the idioms that are related to the word dal.

  • ماہر
  • اگر تمہیں وہ چیز نہیں مل سکتی جِس کی تم خواہش کرتے ہو تو ایسی چیز کی خواہش کرو جو تمہیں مل سکتی ہے
  • جب تمہاری خواہش پوری نہ ہوتی ہو تو ایسی بات کی خواہش کرو جو پوری ہو سکتی ہو
  • دنیا کی اصلیت کا بڑی دیر میں پتہ چلتا ہے
  • احساس کرنا