دل - Dal in English
Meanings of دل - Dal in English are courage, encouragement, generosity. More meanings of دل - dal in english, it's definitions, example sentences, related words, idioms and quotations.
encouragement hostjeomindcouragegenerosityheartinclinationsoliditysoulswarmthicknesswishlentilspulse
دل - Dal Definitions
Please find 14 English definitions related to the word دل - Dal.
- Courage - (noun) : a quality of spirit that enables you to face danger or pain without showing fear
- Encouragement - (noun) : the expression of approval and support
- Generosity - (noun) : acting generously
- Heart - (noun) : a positive feeling of liking
- Host - (noun) : a vast multitude
- Inclination - (noun) : (physics) the angle that a magnetic needle makes with the plane of the horizon
- Lentils - () : considered being the most nutritious and rich of the entire legume family. Lentils are a top source of protein and are high in phosphorous, zinc, iron, calcium, potassium, vitamins A and B complex. Lentils are great when cooked as a curry, as a soup, salad or side dish.
- Mind - (noun) : your intention; what you intend to do
- Pulse - (noun) : (electronics) a sharp transient wave in the normal electrical state (or a series of such transients)
- Solidity - (noun) : the quality of being solid and reliable financially or factually or morally
- Soul - (noun) : the human embodiment of something
- Swarm - (verb) : move in large numbers
- Thickness - (noun) : used of a line or mark
- Wish - (verb) : invoke upon
More words related to the meanings of دل - Dal
More words from English related to دل - Dal
View an extensive list of words below that are related to the meanings of the word دل - Dal in English in English.
abilitygenerosityaccedeacquiescecommemorationconcededisbelieve homologatemindvenerateyieldacceptacknowledgeadmitaffordagreeallowassumebelieveconsentholdkeepobeyreceiveregardadmissiveaccededadeemingadhibitadhibitingadhibitsadmixingconceivingconjectobequitatesupputateaccountdeferheedrespectside withenvisionfancyguessimaginesupposethinkcareconsiderfigure ...
Idioms related to the meaning of دل - Dal
What are the meanings of دل - Dal in English?
Meanings of the word دل - Dal in English are courage, encouragement, generosity, host, jeo, mind, swarm, wish, heart, inclination, pulse, solidity, soul, thickness and lentils. To understand how would you translate the word دل - Dal in English, you can take help from words closely related to دل - Dal or it’s English translations. Some of these words can also be considered دل - Dal synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word دل - Dal. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use دل - Dal in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say دل - Dal in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of دل - Dal with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by dal?
Meanings of dal are courage, encouragement, generosity
What is the synonym of dal?
Synonym of word dal are جراٴت, ہمت, بہادری, دلیری, بے باکی, بل بوتا, دل, دم, دل گردہ, حوصلہ
What are the idioms related to dal?
Here are the idioms that are related to the word dal.
- ماہر
- اگر تمہیں وہ چیز نہیں مل سکتی جِس کی تم خواہش کرتے ہو تو ایسی چیز کی خواہش کرو جو تمہیں مل سکتی ہے
- جب تمہاری خواہش پوری نہ ہوتی ہو تو ایسی بات کی خواہش کرو جو پوری ہو سکتی ہو
- دنیا کی اصلیت کا بڑی دیر میں پتہ چلتا ہے
- احساس کرنا