Naqsha - نقشہ meanings in English
Naqsha - نقشہ meanings in English are chart, design, example, features, model, plan, portrait, predicament, prospect, sketch, indraft, delineation, copy, contour, drawing, figure, manner, map, module, mould, profile, tenor, condition, engraftation Naqsha - نقشہ in English. More meanings of naqsha - نقشہ, it's definitions, example sentences, related words, idioms and quotations.
chart design example features model plan portrait predicament prospect sketch indraft delineation copy contour drawing figure manner map module mould profile tenor condition engraftation
Naqsha - نقشہ Definitions
Please find 143 English and 1 Urdu definitions related to the word Naqsha - نقشہ.
- (noun) : a map designed to assist navigation by air or sea
- (noun) : a visual display of information
- (verb) : plan in detail
- (verb) : make a chart of
- (verb) : represent by means of a graph
- (noun) : (usually plural) a listing of best-selling recorded music
- (noun) : a feature (or the order or arrangement of features) of anything having a complex structure
- (noun) : a line drawn on a map connecting points of equal height
- (verb) : form the contours of
- (noun) : matter to be printed; exclusive of graphical materials
- (noun) : material suitable for a journalistic account
- (noun) : a reproduction of a written record (e.g. of a legal or school record)
- (verb) : make a replica of
- (verb) : copy down as is
- (verb) : reproduce someone's behavior or looks
- (noun) : a thing made to be similar or identical to another thing
- (verb) : reproduce or make an exact copy of
- (noun) : the procedure that is varied in order to estimate a variable's effect by comparison with a control condition
- (noun) : an assumption on which rests the validity or effect of something else
- (noun) : (usually plural) a statement of what is required as part of an agreement
- (noun) : a mode of being or form of existence of a person or thing
- (noun) : a state at a particular time
- (verb) : establish a conditioned response
- (verb) : apply conditioner to in order to make smooth and shiny
- (verb) : put into a better state
- (verb) : specify as a condition or requirement in a contract or agreement; make an express demand or provision in an agreement
- (verb) : develop (a child's or animal's) behavior by instruction and practice; especially to teach self-control
- (noun) : an illness, disease, or other medical problem
- (noun) : the state of (good) health (especially in the phrases in condition' or in shape' or out of condition' or out of shape')
- (noun) : the act of moving a load by drawing or pulling
- (noun) : act of getting or draining something such as electricity or a liquid from a source
- (noun) : a representation of forms or objects on a surface by means of lines
- (noun) : the creation of artistic pictures or diagrams
- (noun) : players buy (or are given) chances and prizes are distributed by casting lots
- (noun) : an illustration that is drawn by hand and published in a book, magazine, or newspaper
- (verb) : judge to be probable
- (verb) : be or play a part of or in
- (verb) : imagine; conceive of; see in one's mind
- (noun) : a predetermined set of movements in dancing or skating
- (noun) : a model of a bodily form (especially of a person)
- (noun) : the impression produced by a person
- (noun) : a unitary percept having structure and coherence that is the object of attention and that stands out against a ground
- (noun) : a diagram or picture illustrating textual material
- (noun) : an amount of money expressed numerically
- (noun) : a combination of points and lines and planes that form a visible palpable shape
- (noun) : a well-known or notable person
- (noun) : a decorative or artistic work
- (noun) : language used in a figurative or nonliteral sense
- (verb) : understand
- (noun) : one of the elements that collectively form a system of numeration
- (noun) : a diagrammatic representation of the earth's surface (or part of it)
- (verb) : locate within a specific region of a chromosome in relation to known DNA or gene sequences
- (verb) : to establish a mapping (of mathematical elements or sets)
- (verb) : explore or survey for the purpose of making a map
- (verb) : make a map of; show or establish the features of details of
- (verb) : depict as if on a map
- (verb) : plan, delineate, or arrange in detail
- (noun) : (mathematics) a mathematical relation such that each element of a given set (the domain of the function) is associated with an element of another set (the range of the function)
- (noun) : a woman who wears clothes to display fashions
- (noun) : the act of representing something (usually on a smaller scale)
- (noun) : representation of something (sometimes on a smaller scale)
- (noun) : a type of product
- (noun) : a representative form or pattern
- (noun) : a person who poses for a photographer or painter or sculptor
- (noun) : something to be imitated
- (verb) : display (clothes) as a mannequin
- (verb) : form in clay, wax, etc
- (verb) : construct a model of
- (verb) : create a representation or model of
- (verb) : plan or create according to a model or models
- (adjective satellite) : worthy of imitation
- (noun) : a hypothetical description of a complex entity or process
- (noun) : one of the inherent cognitive or perceptual powers of the mind
- (noun) : a self-contained component (unit or item) that is used in combination with other components
- (noun) : computer circuit consisting of an assembly of electronic components (as of computer hardware)
- (noun) : detachable compartment of a spacecraft
- (noun) : the distinctive form in which a thing is made
- (noun) : container into which liquid is poured to create a given shape when it hardens
- (verb) : form by pouring (e.g., wax or hot metal) into a cast or mold
- (noun) : the process of becoming mildewed
- (verb) : form in clay, wax, etc
- (noun) : sculpture produced by molding
- (noun) : a fungus that produces a superficial growth on various kinds of damp or decaying organic matter
- (noun) : loose soil rich in organic matter
- (noun) : a dish or dessert that is formed in or on a mold
- (noun) : a distinctive nature, character, or type
- (noun) : a word picture of a person's appearance and character
- (noun) : any likeness of a person, in any medium
- (noun) : biographical sketch
- (noun) : an analysis (often in graphical form) representing the extent to which something exhibits various characteristics
- (noun) : a vertical section of the Earth's crust showing the different horizons or layers
- (noun) : degree of exposure to public notice
- (verb) : represent in profile, by drawing or painting
- (verb) : write about
- (noun) : an outline of something (especially a human face as seen from one side)
- (verb) : describe roughly or briefly or give the main points or summary of
- (noun) : preliminary drawing for later elaboration
- (noun) : short descriptive summary (of events)
- (noun) : a brief literary description
- (noun) : a humorous or satirical drawing published in a newspaper or magazine
- (verb) : make a sketch of
- (noun) : the pitch range of the highest male voice
- (noun) : the adult male singing voice above baritone
- (noun) : an adult male with a tenor voice
- (adjective satellite) : of or close in range to the highest natural adult male voice
- (adjective satellite) : (of a musical instrument) intermediate between alto and baritone or bass
- (noun) : the general meaning or substance of an utterance
- (noun) : a settled or prevailing or habitual course of a person's life
- (noun) : a graphic or vivid verbal description
- (noun) : representation by drawing or painting etc
- (noun) : something intended as a guide for making something else
- (noun) : the creation of something in the mind
- (noun) : a decorative or artistic work
- (noun) : the act of working out the form of something (as by making a sketch or outline or plan)
- (noun) : a preliminary sketch indicating the plan for something
- (noun) : an arrangement scheme
- (verb) : intend or have as a purpose
- (verb) : plan something for a specific role or purpose or effect
- (verb) : create designs
- (verb) : make or work out a plan for; devise
- (verb) : conceive or fashion in the mind; invent
- (verb) : make a design of; plan out in systematic, often graphic form
- (verb) : create the design for; create or execute in an artistic or highly skilled manner
- (noun) : an occurrence of something
- (noun) : punishment intended as a warning to others
- (noun) : a representative form or pattern
- (noun) : something to be imitated
- (noun) : a task performed or problem solved in order to develop skill or understanding
- (noun) : an item of information that is typical of a class or group
- (noun) : a series of steps to be carried out or goals to be accomplished
- (noun) : scale drawing of a structure
- (verb) : have the will and intention to carry out some action
- (noun) : an arrangement scheme
- (verb) : make plans for something
- (verb) : make or work out a plan for; devise
- (verb) : make a design of; plan out in systematic, often graphic form
- (noun) : someone who is considered for something (for an office or prize or honor etc.)
- (noun) : belief about (or mental picture of) the future
- (noun) : the visual percept of a region
- (noun) : the possibility of future success
- (noun) : a prediction of the course of a disease
- (verb) : search for something desirable
- (verb) : explore for useful or valuable things or substances, such as minerals
- جَلدی جَلدی میں لکیریں ڈال کر بنائی ہوئی ڈَرائنگ جِس سے کِسی شے کے بارے میں سَرسَری آگاہی ہو جاۓ
More words related to the meanings of Naqsha - نقشہ
More words from English related to Naqsha - نقشہ
View an extensive list of words below that are related to the meanings of the word Naqsha - نقشہ meanings in English in English.
accompanimentconditioneventstanceaccountaffectionmoodnarrativenatureparticularspositionpostureprospectqualityremarkreportsituationstatestatementstoryenvisionfancyguessimaginemindsupposethinkcareconsiderfigureheedobeyobservepremeditatereckreflectregardnotionatetake careactactionarduouscallingjoblustmakingmanufactureploytendvalue ... workbusinessdesigndesireembroideryemploymentengagementerrand functionintentionlabourmetierobjectoccupationpurporttaskundertakinguseworkmanshipchoreskamcom werkaccentuationgetupmienmodegenremannerstyletypewaydistylesguisesstyletsstypticsaffiliateconstituteconstructcreateerectfablefabricatefeignfoundframemakemanufacturesmouldbuildcoinconfigureedifyforgeinitiatelaughproducevampfabricatingmeakingfashionformulateshapeapeemulatefollow:gesticulateimitatemimicmockmodelnarratequotesimulatetranscribingcopycounterfeitduplicateimpersonatepersonaterelateremittake aftertranscribetransferduplicatingaphorismdictumlikelikenessquasiwakeanalogousexampleproverbrecordresemblingsimilarapparitioncontourfairnessideapersonagesimilitudefacefeatureimagevisageroopconfigurationconjunctureemblemeventualityguiselikelihoodlinementphasephasissemblancesymmetryappearancecasecountenanceformgestaltmodalityplightprocesseffigy aspectdiagramformationget upnumeralpatternvarietyshape upamorphismappliancegangwaygategatroadwayroutetrackcoursefarepathroadwalkapproach pathestuarialexhausttowing pathestoppagesestopsestrangesestuariesfootwaylanewaypathicpathingroukwayedaquariusbucketschemedholldooldoolearrangedightdisposeflourishgarnishimprovecorrectembellishpreenrectifyblack earthblazondrawillustrateportraysketchpicturizingblockbodyingotmatrixtemplatebucklerescarpmentglacisprecipiceramptargetdowngradedownhillgradientinclineshieldslopeshieldedchieldchieldsshieldlesscalculatecomputecountestimatereckontotcalciningcastingoccurenceshapercastdienormceremonialcustomtraditionceremonyformalityhabitudeinstitutelawordinationpracticeritualrulewontrit.ritualiseritzyrittersrittingrittsritualizesritziestconstitutionusagechartchartschartechivalrycharacterdispositionhabitpersonapersonalityrolerolescircleoceansurroundingcircumambientcircumferenceencompassingunabridgedambageambientambientsclayclassgenderdenominationgenuskindsortspeciescoatcarddrawingemblazonrytableiconicillustrationpaintingphotographpictureportraitpicpicaresquepicotpicturedpicturingportraiturephotoedpicotedpicoteepicotspicrapicratepicratespicricpicritepicritespicsportraysphotocomedycomfitcounterpartgesticulationmimeryspoofetaleactinganecdoteapingcopyingexemplarimitatingimitationimpersonationmimickingmimicrymockernarrationprintreplicareproductionsimulationtranscriptduplicabilityduplicableduplicatablereduplicationreplicationtranscribedduplicatedreplicatescentuplicateconduplicateconduplicationduplicatureinduplicatereplicantopinespeculateconceivecontemplatedeliberatedevisemeditateponderoutthoughtthilkcontextpurportstenoragreementarrangementconnectionmethodordersystemfeaturedmaskfaceliftfaceplatefacervolte facefeckfacoundepistrophelettersephemeridsepistasesepistaxesepistlersepistlesepistoletsepistoliseepistylesepithetslineamentslineationsrescriptsterriesterremotecopiedcoppedcoppycopistversionsobstrictionpactbetgambleprovisionprovisostakestipulationtermwagerprerequisitestipuleecstasyrapturethisaffaircircumstanceinstantlifepredicamentpresentpresent tensevitalitykeeplikingnountrimongoingmoralbehaviourchiccuttingdemeanourfoundinggarbvoguemodiusmodussceattcontingencyfeasibility likelinessverisimilitudepossepossibilityforeseeablepossiblenesspossumprobabilityprospicienceposspossieprospectioncraftcuremakeshiftmanoeuvretacttacticadviceartificedeliberationdevicegadgetgimmickginopinionplanpolicygradualitymaneuverabilitymanoeuvrabilitytacticaltractarianismgradinetactualityplacitorystipulasustulatecubitssizedimensiongaugemeasurementmensurationmetemeterquantitysurveyunsnapdraught raisinallurementattractiongravitationmagnetismpredilectionpredispositionseductioncatchydigressiveinflectionalcatchinesscombustingembraciveembranglesembrogliosengildingengorgingengouemententoticgravitatedgravlaxosmioustempingattractabilityattractileattractivityconvicinityembrewgraveolencegravicincultivationdrowsingdrailingdrawingsdrawleddrawlingsynopsiscaricaturedelineationdraft mapmonkeyoutlineprofileschemaoutlinedsketchersketchinessoutlayingoutlinearoutlinesoutliningsketchedsketchiersketchingtableauxunderlinedunderlinesmanurementearnest identitysingularityverityfactgenuinenessrealitytruthfactualityrealinerealnessrealtyfacturefuracityrealiarealtieactualnessactuosityfacfactoreallegeversabilityeffuseembodytaunticonsimulacrummarkmottostepcarvingcharmengravingfeaturesimpressioninscriptionstampembowelmentendeavourenterpriseaimattemptpurposeviewstartfacetadvantagedirectionflankfrontleveragesidewingaspectualonsidesidesaddlefaceteaspectionfacetteside takingside wheelfermentrotrotgutrottingrotundnessrotchrotcherotgrassrotgrassesrotingrotundingfictionforeclosureligationmachinationphraseologybondcompositionconstraintlimitationobstructionphraselogyqualmrestrictionclosuredebarmentclosingsclosuresdebarmentsdebarringoutagescloshincloisteroffuscationmodishnesspathwaysubterfugetechniquebreedingmodus operandithringchurlishfustfustinessmustinessmildewmildewedmildewingmildewsmildewycupmeasurequartscaleyardstickscaleygeldamountdoughedictmoneynumbersummonesesamountedamountingsumszodiacsglorymagnificencemajestydignityeleganceeminencegrandeurpomppowershanshawnseangnomonmodularityindicatordeportmenttunelimningcarvelcarveryembalmingsembossersemboweringengraftsengrailsengravenembolismalembolismaticembolismaticalembowelingengraffmentengrailmentdecorationequipage splendourmixturesynthesistemperconstructiondecoctioninventionreciperusetricksyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismstaturetontoneveinportdescriptionfoundation superiorsurpassinghigh fashionroutinesynthesizesynthesizingmeldmoduleparadigmmock upprototypesamplespecimenspeculumsubsamplemoralsstupidityviewpointattitudeposetackmotiveanimusdestinationgoalimplicationintentmeaningobjectiveobligatoryejectivemottemottoedobjectivationpurposermouldingmustneedwantaboutcoefficientnumerationnumerologicalintegersnumerablynumeratedaccumberdigituleoverturetabulatesplotprojectproposalrecommendationsuggestionpropositussuggestibilitydiscommendpreposedpropensionpropinespropiningproposestipsifyingdiscommendationpresupposalpropicepropinationsuggestmentanalogyinstancemetaphorparableprecedentsimilesymbolexemplificationindumentprecedentialexemplumprecedentsexamplaryexemplarinessexemplaritypackagerpackerspromenadeconductgaitpassagefuriesprogramconcotiondemarcheprogrammeheighttabulateastronomylineamentphysiqueknackmannerismeditionprescriptiontranscriptionversionvolumeascriptionethnarchprescriptsuperscriptionepinastyepistyleepithemepithetonepistolicalepistomeprescriptibilitypresignificationprespinalpresstrictionrescriptionreplicatetracemeansdismembermentrecisionterraintracteffortturmonadunit
Idioms related to the meaning of Naqsha - نقشہ
What are the meanings of Naqsha - نقشہ in English?
Meanings of the word Naqsha - نقشہ in English are chart, contour, copy, condition, drawing, figure, manner, map, model, module, mould, portrait, profile, sketch, tenor, delineation, design, example, plan, predicament, prospect, features, indraft and engraftation. To understand how would you translate the word Naqsha - نقشہ in English, you can take help from words closely related to Naqsha - نقشہ or it’s English translations. Some of these words can also be considered Naqsha - نقشہ synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Naqsha - نقشہ. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Naqsha - نقشہ in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Naqsha - نقشہ in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Naqsha - نقشہ with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by naqsha?
Meanings of naqsha are chart, contour, copy, condition, drawing, figure, manner, map, model, module, mould, portrait, profile, sketch, tenor, delineation, design, example, plan, predicament, prospect, features, indraft and engraftation
Whats the definition of naqsha?
Definition of the naqsha are
- a map designed to assist navigation by air or sea
- a visual display of information
- plan in detail
- make a chart of
- represent by means of a graph
- (usually plural) a listing of best-selling recorded music
- a feature (or the order or arrangement of features) of anything having a complex structure
- a line drawn on a map connecting points of equal height
- form the contours of
- matter to be printed; exclusive of graphical materials
- material suitable for a journalistic account
- a reproduction of a written record (e.g. of a legal or school record)
- make a replica of
- copy down as is
- reproduce someone's behavior or looks
- a thing made to be similar or identical to another thing
- reproduce or make an exact copy of
- the procedure that is varied in order to estimate a variable's effect by comparison with a control condition
- an assumption on which rests the validity or effect of something else
- (usually plural) a statement of what is required as part of an agreement
- a mode of being or form of existence of a person or thing
- a state at a particular time
- establish a conditioned response
- apply conditioner to in order to make smooth and shiny
- put into a better state
- specify as a condition or requirement in a contract or agreement; make an express demand or provision in an agreement
- develop (a child's or animal's) behavior by instruction and practice; especially to teach self-control
- an illness, disease, or other medical problem
- the state of (good) health (especially in the phrases in condition' or in shape' or out of condition' or out of shape')
- the act of moving a load by drawing or pulling
- act of getting or draining something such as electricity or a liquid from a source
- a representation of forms or objects on a surface by means of lines
- the creation of artistic pictures or diagrams
- players buy (or are given) chances and prizes are distributed by casting lots
- an illustration that is drawn by hand and published in a book, magazine, or newspaper
- judge to be probable
- be or play a part of or in
- imagine; conceive of; see in one's mind
- a predetermined set of movements in dancing or skating
- a model of a bodily form (especially of a person)
- the impression produced by a person
- a unitary percept having structure and coherence that is the object of attention and that stands out against a ground
- a diagram or picture illustrating textual material
- an amount of money expressed numerically
- a combination of points and lines and planes that form a visible palpable shape
- a well-known or notable person
- a decorative or artistic work
- language used in a figurative or nonliteral sense
- understand
- one of the elements that collectively form a system of numeration
- a diagrammatic representation of the earth's surface (or part of it)
- locate within a specific region of a chromosome in relation to known DNA or gene sequences
- to establish a mapping (of mathematical elements or sets)
- explore or survey for the purpose of making a map
- make a map of; show or establish the features of details of
- depict as if on a map
- plan, delineate, or arrange in detail
- (mathematics) a mathematical relation such that each element of a given set (the domain of the function) is associated with an element of another set (the range of the function)
- a woman who wears clothes to display fashions
- the act of representing something (usually on a smaller scale)
- representation of something (sometimes on a smaller scale)
- a type of product
- a representative form or pattern
- a person who poses for a photographer or painter or sculptor
- something to be imitated
- display (clothes) as a mannequin
- form in clay, wax, etc
- construct a model of
- create a representation or model of
- plan or create according to a model or models
- worthy of imitation
- a hypothetical description of a complex entity or process
- one of the inherent cognitive or perceptual powers of the mind
- a self-contained component (unit or item) that is used in combination with other components
- computer circuit consisting of an assembly of electronic components (as of computer hardware)
- detachable compartment of a spacecraft
- the distinctive form in which a thing is made
- container into which liquid is poured to create a given shape when it hardens
- form by pouring (e.g., wax or hot metal) into a cast or mold
- the process of becoming mildewed
- form in clay, wax, etc
- sculpture produced by molding
- a fungus that produces a superficial growth on various kinds of damp or decaying organic matter
- loose soil rich in organic matter
- a dish or dessert that is formed in or on a mold
- a distinctive nature, character, or type
- a word picture of a person's appearance and character
- any likeness of a person, in any medium
- biographical sketch
- an analysis (often in graphical form) representing the extent to which something exhibits various characteristics
- a vertical section of the Earth's crust showing the different horizons or layers
- degree of exposure to public notice
- represent in profile, by drawing or painting
- write about
- an outline of something (especially a human face as seen from one side)
- describe roughly or briefly or give the main points or summary of
- preliminary drawing for later elaboration
- short descriptive summary (of events)
- a brief literary description
- a humorous or satirical drawing published in a newspaper or magazine
- make a sketch of
- the pitch range of the highest male voice
- the adult male singing voice above baritone
- an adult male with a tenor voice
- of or close in range to the highest natural adult male voice
- (of a musical instrument) intermediate between alto and baritone or bass
- the general meaning or substance of an utterance
- a settled or prevailing or habitual course of a person's life
- a graphic or vivid verbal description
- representation by drawing or painting etc
- something intended as a guide for making something else
- the creation of something in the mind
- a decorative or artistic work
- the act of working out the form of something (as by making a sketch or outline or plan)
- a preliminary sketch indicating the plan for something
- an arrangement scheme
- intend or have as a purpose
- plan something for a specific role or purpose or effect
- create designs
- make or work out a plan for; devise
- conceive or fashion in the mind; invent
- make a design of; plan out in systematic, often graphic form
- create the design for; create or execute in an artistic or highly skilled manner
- an occurrence of something
- punishment intended as a warning to others
- a representative form or pattern
- something to be imitated
- a task performed or problem solved in order to develop skill or understanding
- an item of information that is typical of a class or group
- a series of steps to be carried out or goals to be accomplished
- scale drawing of a structure
- have the will and intention to carry out some action
- an arrangement scheme
- make plans for something
- make or work out a plan for; devise
- make a design of; plan out in systematic, often graphic form
- someone who is considered for something (for an office or prize or honor etc.)
- belief about (or mental picture of) the future
- the visual percept of a region
- the possibility of future success
- a prediction of the course of a disease
- search for something desirable
- explore for useful or valuable things or substances, such as minerals
- جَلدی جَلدی میں لکیریں ڈال کر بنائی ہوئی ڈَرائنگ جِس سے کِسی شے کے بارے میں سَرسَری آگاہی ہو جاۓ
What is the synonym of naqsha?
Synonym of word naqsha are خریطہ, چارٹ, نقشہ, خریتہ, روپ, صورت, ڈھانچ, شکل, چہرہ, ہیئت
What are the idioms related to naqsha?
Here are the idioms that are related to the word naqsha.
- Condition makes and condition breaks
- Off the map
- Papery plan
- The tenor of one's life
- The requisite for obtaining copy