giraft - گرفت meanings in English

giraft - گرفت meanings in English are grasp, gripping, capturing, grabs, gracing, graip, graips, graping, grasper, grasps, grike, griped, gripper, grips, griping, gripes, grip, hold, objection, taking, valency, clamp, clutch, criticism, grapple, gripe, handle, lock, seizing, grippleness giraft - گرفت in English. More meanings of giraft - گرفت, it's definitions, example sentences, related words, idioms and quotations.

grasp gripping capturing grabs gracing graip graips graping grasper grasps grike griped gripper grips griping gripes grip hold objection taking valency clamp clutch criticism grapple gripe handle lock seizing grippleness

Facebook Chatbots

giraft - گرفت Definitions

Please find 114 English and 1 Urdu definitions related to the word giraft - گرفت.

  • (verb) : impose or inflict forcefully
  • (verb) : fasten or fix with a clamp
  • (noun) : a device (generally used by carpenters) that holds things firmly together
  • (noun) : a collection of things or persons to be handled together
  • (noun) : a coupling that connects or disconnects driving and driven parts of a driving mechanism
  • (noun) : a number of birds hatched at the same time
  • (noun) : a tense critical situation
  • (noun) : the act of grasping
  • (verb) : affect
  • (verb) : take hold of; grab
  • (verb) : hold firmly, usually with one's hands
  • (noun) : a pedal or lever that engages or disengages a rotating shaft and a driving mechanism
  • (noun) : a woman's strapless purse that is carried in the hand
  • (noun) : a dredging bucket with hinges like the shell of a clam
  • (noun) : a tool consisting of several hooks for grasping and holding; often thrown with a rope
  • (noun) : the act of engaging in close hand-to-hand combat
  • (verb) : to grip or seize, as in a wrestling match
  • (verb) : succeed in doing, achieving, or producing (something) with the limited or inadequate means available
  • (noun) : understanding of the nature or meaning or quality or magnitude of something
  • (verb) : get the meaning of something
  • (noun) : the act of grasping
  • (noun) : the limit of capability
  • (verb) : hold firmly
  • (noun) : an intellectual hold or understanding
  • (noun) : the act of grasping
  • (verb) : to render motionless, as with a fixed stare or by arousing terror or awe
  • (verb) : to grip or seize, as in a wrestling match
  • (noun) : worker who moves the camera around while a film or television show is being made
  • (noun) : the friction between a body and the surface on which it moves (as between an automobile tire and the road)
  • (noun) : the appendage to an object that is designed to be held in order to use or move it
  • (noun) : a flat wire hairpin whose prongs press tightly together; used to hold bobbed hair in place
  • (verb) : hold fast or firmly
  • (noun) : a portable rectangular container for carrying clothes
  • (noun) : an intellectual hold or understanding
  • (verb) : have room for; hold without crowding
  • (verb) : be pertinent or relevant or applicable
  • (noun) : understanding of the nature or meaning or quality or magnitude of something
  • (verb) : cause to stop
  • (verb) : drink alcohol without showing ill effects
  • (verb) : support or hold in a certain manner
  • (verb) : contain or hold; have within
  • (verb) : lessen the intensity of; temper; hold in restraint; hold or keep within limits
  • (noun) : the act of grasping
  • (verb) : be capable of holding or containing
  • (verb) : maintain (a theory, thoughts, or feelings)
  • (verb) : organize or be responsible for
  • (noun) : the appendage to an object that is designed to be held in order to use or move it
  • (verb) : protect against a challenge or attack
  • (noun) : a cell in a jail or prison
  • (noun) : a stronghold
  • (noun) : power by which something or someone is affected or dominated
  • (noun) : a state of being confined (usually for a short time)
  • (noun) : time during which some action is awaited
  • (noun) : the space in a ship or aircraft for storing cargo
  • (verb) : take and maintain control over, often by violent means
  • (verb) : keep from departing
  • (verb) : stop dealing with
  • (verb) : remain in a certain state, position, or condition
  • (verb) : have as a major characteristic
  • (verb) : remain committed to
  • (verb) : assert or affirm
  • (verb) : hold the attention of
  • (verb) : keep from exhaling or expelling
  • (verb) : aim, point, or direct
  • (verb) : have or hold in one's hands or grip
  • (verb) : be the physical support of; carry the weight of
  • (verb) : cover as for protection against noise or smell
  • (verb) : secure and keep for possible future use or application
  • (verb) : have rightfully; of rights, titles, and offices
  • (verb) : arrange for and reserve (something for someone else) in advance
  • (verb) : be valid, applicable, or true
  • (verb) : keep in mind or convey as a conviction or view
  • (verb) : have or possess, either in a concrete or an abstract sense
  • (verb) : resist or confront with resistance
  • (verb) : declare to be
  • (verb) : to close within bounds, or otherwise limit or deprive of free movement
  • (verb) : cause to continue in a certain state, position, or activity; e.g., keep clean'
  • (noun) : (law) a procedure whereby a party to a suit says that a particular line of questioning or a particular witness or a piece of evidence or other matter is improper and should not be continued and asks the court to rule on its impropriety or illegality
  • (noun) : the speech act of objecting
  • (noun) : the act of expressing earnest opposition or protest
  • (noun) : the act of someone who picks up or takes something
  • (adjective satellite) : very attractive; capturing interest
  • (noun) : the phenomenon of forming chemical bonds
  • (noun) : (chemistry) a property of atoms or radicals; their combining power given in terms of the number of hydrogen atoms (or the equivalent)
  • (noun) : (biology) a relative capacity to unite or react or interact as with antigens or a biological substrate
  • (noun) : a serious examination and judgment of something
  • (noun) : a written evaluation of a work of literature
  • (noun) : disapproval expressed by pointing out faults or shortcomings
  • (noun) : acute abdominal pain (especially in infants)
  • (noun) : acute abdominal pain (especially in infants)
  • (adjective satellite) : capable of arousing and holding the attention
  • (noun) : the appendage to an object that is designed to be held in order to use or move it
  • (verb) : touch, lift, or hold with the hands
  • (verb) : interact in a certain way
  • (verb) : handle effectively
  • (verb) : act on verbally or in some form of artistic expression
  • (verb) : show and train
  • (noun) : a strand or cluster of hair
  • (verb) : keep engaged
  • (noun) : a restraint incorporated into the ignition switch to prevent the use of a vehicle by persons who do not have the key
  • (verb) : hold in a locking position
  • (verb) : become engaged or intermeshed with one another
  • (noun) : any wrestling hold in which some part of the opponent's body is twisted or pressured
  • (noun) : a fastener fitted to a door or drawer to keep it firmly closed
  • (noun) : a mechanism that detonates the charge of a gun
  • (verb) : become rigid or immoveable
  • (verb) : place in a place where something cannot be removed or someone cannot escape
  • (verb) : fasten with a lock
  • (verb) : build locks in order to facilitate the navigation of vessels
  • (verb) : hold fast (in a certain state)
  • (verb) : pass by means through a lock in a waterway
  • (noun) : enclosure consisting of a section of canal that can be closed to control the water level; used to raise or lower vessels that pass through it
  • (noun) : the act of gripping something firmly with the hands (or the tentacles)
  • (noun) : small stuff that is used for lashing two or more ropes together
  • ہائیڈروجن کے ایک یا زیادہ جوہروں سے ترکیب

More words related to the meanings of giraft - گرفت

Clampپٹی patti پتر جُڑ جانا یا لگنا شکنجہ shikanjah شکنجہ Shikanja گرفت giraft
Clutchپکڑنا pakarna قبضہ کرنا qabzah karna مُوٹھ چنگل chungal چنگل changul پنجہ panjah پنجہ Panjaa قبضہ qabzah قبضہ Qabza دستہ dastah دستہ Dasta ہاتھ haath ہاتھ Hath مٹھی mutthi مٹھی Muthi لپکنا lapakna گرفت giraft پھنندا phannda
Grappleکانٹا kaanta آنکڑا aankra آنکڑا Aankud آنکڑا Aankur زنبور zanbuur قلاب qullaab ہاتھا پائی جٹنا jutna گتھنا Gathna بھڑ جانا bhir jaana ہاتھا پائی کرنا گتھم گتھا مٹھ بھیڑ گرفت giraft گتھ جانا guth jaana گرفت میں لانا giraft meyn laana ہاتھا پائ کرنا haatha paa i karna
Graspسمجھنا samajhna پکڑنا pakarna گہنا gaehna گہنا Gehna قبضہ کرنا qabzah karna ادراک idraak ادراک adraak پکڑ pakar پکڑ Pakarh پکڑ Pakad تھامنا thaamna چنگل chungal چنگل changul پنجہ panjah پنجہ Panjaa قبضہ qabzah قبضہ Qabza گرفت کرنا گرفت giraft کولی Koli کھپچی khapachchi کھپچی Khipchi قابو qaabu قابو Qaboo قابو Qabu عبور ubuur عبور Uboor دخل dakhl دخل Dakhal پھندا phanda قابو کرنا qaabu karna
Gripپکڑنا pakarna نالی naali پکڑ pakar پکڑ Pakarh پکڑ Pakad تھامنا thaamna پنجہ panjah پنجہ Panjaa قبضہ qabzah قبضہ Qabza دستہ dastah دستہ Dasta دست dast گرفت giraft قابو qaabu قابو Qaboo قابو Qabu عبور ubuur عبور Uboor مہارت mahaarat مہارت Maharat کلپ kalap کلپ Clip چٹکی chutki مٹھی میں لینا مضبوط پکڑنا متوجہ کرنا mutawajjah karna متوجہ کرنا mutawajjoh karna توجہ متعطف کرنا چھوٹی خندق chhoti khandaq خندق کھودنا khandaq khodna
Gripeظلم zulm ظلم Zulum پکڑنا pakarna اینٹھنا aenthna دبانا dabaana دبانا Dahana جبر jabr جبر Jabar بھینچنا bhiinchna بھینچنا Bhenchna اینٹھن aenthan اینٹھن ainthan اذیت دینا aziiyat deyna گرفت giraft ستم sitam مضبوط گرفت کرنا مٹھی میں ڈالنا گرفت میں لانا giraft meyn laana ظلم ڈھانا zulm dhaana گرفت میں ہونا giraft meyn hona گدھ gidh
Holdماننا maanna رکھنا rakhna پکڑنا pakarna تھمو Thamo پکڑ pakar پکڑ Pakarh پکڑ Pakad تھامنا thaamna منانا manaana منانا Manana قبضہ qabzah قبضہ Qabza رہنا rahina رہنا raehna رہنا Rehna چلنا chalna ٹھیرنا thaerna ٹھیرنا Thairna ٹکنا tikna ٹکنا tikana گرفت کرنا گرفت giraft قابو qaabu قابو Qaboo قابو Qabu مٹھیانا Muthiyana تھام Thaam ٹھیرو Thero چپ رہو بس کرو ہونا hona سادھنا saadhna سدھانا sadhaana سدھانا Sudhana تھمانا thamaana
Objectionکلام kalaam عذر uzr عذر Uzar پکڑ pakar پکڑ Pakarh پکڑ Pakad اختلاف ekhtelaaf اختلاف ikhtelaaf اختلاف ikhtilaaf حجت hujjat حجت Hijjat قباحت qabaahat گرفت giraft اعتراض eteraaz اعتراض Aetraz اعتراض Aeytraaz جرح jarah جرح jirah ترکنا Tarakna اظہار ناپسندیدگی شاخسانہ shaakh saanah شاخسانہ shaakhsaanah
Takingگرفتاری giraftaari پکڑ pakar پکڑ Pakarh پکڑ Pakad اخذ akhz اخذ Akhaz گرفت giraft دلکش dil kash دلکش Dilkash دلکش Dilkush موہنی Mohani پزیر paziir پزیر Pazeer پزیر Pazir دل ربا dil ruba دل چسپ لین leyn لین Lane دل ربا(گرفتار) dil ruba giraftaari
Valencyگرفت giraft ویلنسی Valency کسی عنصر کے ایک جوہر کی قوت ظرفیت zarfiyat
Criticismپکڑ pakar پکڑ Pakarh پکڑ Pakad گرفت giraft اعتراض eteraaz اعتراض Aetraz اعتراض Aeytraaz حرف گیری harf giiri تنقید tanqiid تنقید Tanqeed
Gripesگرفت giraft مروڑ maror مروڑ Marorr
Gripingگرفت giraft
Grippingگرفت giraft
Handleچھونا chhuuna چھونا Choona قبضہ qabzah قبضہ Qabza گرفت giraft ڈنڈی dandi ہتھا hattha ہتھا Hatha بینٹ beynt بینٹ Bent
Lockلٹ lat زلف zulf گرفت giraft محبوس کرنا maehbuus karna مقفل کرنا muqaffal karna تالا لگانا taala lagaana قفل qufl قفل Qafal قفل Qafl تالا taala تالا Tala لِٹ Sleden
Seizingپکڑ pakar پکڑ Pakarh پکڑ Pakad بندھن bandhan بندھن Bundhan اخذ akhz اخذ Akhaz گرفت giraft
Capturingگرفت giraft
Grabsگرفت giraft
Gracingگرفت giraft
Graipگرفت giraft
Graipsگرفت giraft
Grapingگرفت giraft
Grasperگرفت giraft
Graspsگرفت giraft
Grikeگرفت giraft
Gripedگرفت giraft
Gripperگرفت giraft
Gripsگرفت giraft
Gripplenessگرفت giraft

More words from English related to giraft - گرفت

View an extensive list of words below that are related to the meanings of the word giraft - گرفت meanings in English in English.

abusesgrievousnessgripeoppressioncrueltyheartlessnessinjusticetyrannywrongatrociousnessatrocitycrueltiesoppilationoppressestyrannesstyranniestyrannisesantrustionoffensionabutfeel fingerfumblepighandhandletouchtouch upaccedeacquiescecommemorationconcededisbelieve homologatemindvenerateyieldacceptacknowledgeadmitaffordagreeallowassumebelieveconsentholdkeepobeyreceive ...

Idioms related to the meaning of giraft - گرفت

Englishاردو
Gold opens all lock no lock will hold against the power of goldزر سے کیا نہیں ہو سکتا
Criticism is easy and art is difficultکام کرنے کے مُقابلہ میں نُکتہ چینی آسان ہے
To grapple withسلجھانا مقابلہ
To lose one gripکنٹرول کھو دینا
To lose one s gripکنٹرول کھو دینا
To handle with kid glovesآسانی سے
To throw the handle after the lost hatchetکھوئی ہوئی کلہاڑی پیچھے دستہ گنوانا
Women and workmen are difficult to handleعورتوں اور کاریگروں کو قابو میں لانا مشکل کام ہے
By always taking out and never putting in the bottom is soon reachedنکالتے نکالتے قارون کا خزانہ بھی خالی ہو جاتا ہے
Grasp all lose allآدھی چھوڑ ساری کو دھاۓ آدھی رہے نہ ساری پاۓ
Grasp atپکڑ لینا
Hoarding is nothing but taking pains for othersجوڑ جوڑ مر جائیں گے مال جمائی کھائیں گے
Out of one graspپہنچ سے باہر
The gladiator is taking counsel after entering the arenaمرے پیچھے دید اوکھلی میں سرد یا تو موسلوں کا کیا ڈر
Out of ones graspپہنچ سے باہر
What's taking so longمیرا مطلب یہ نہیں تھا
Lock stock and barrelمکمل
Lock upبند کر دینا۔ حفاظت سے رکھنا
Lock your door and keep your neighbours honestاپنے مال کی حفاظت نہیں کرتا اور چور کا نام دھرتا ہے
Prayer should be the kay of the day and the lock of the nightدعا صبح سب سے پہلے اور رات کو سب سے بعد
View More ...

What are the meanings of giraft - گرفت in English?

Meanings of the word giraft - گرفت in English are clamp, clutch, grapple, grasp, grip, gripe, hold, objection, taking, valency, criticism, gripes, griping, gripping, handle, lock, seizing, capturing, grabs, gracing, graip, graips, graping, grasper, grasps, grike, griped, gripper, grips and grippleness. To understand how would you translate the word giraft - گرفت in English, you can take help from words closely related to giraft - گرفت or it’s English translations. Some of these words can also be considered giraft - گرفت synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word giraft - گرفت. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use giraft - گرفت in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.

We have tried our level best to provide you as much detail on how to say giraft - گرفت in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of giraft - گرفت with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.

Frequently Asked Questions (FAQ)

What do you mean by گرفت?

Meanings of گرفت are clamp, clutch, grapple, grasp, grip, gripe, hold, objection, taking, valency, criticism, gripes, griping, gripping, handle, lock, seizing, capturing, grabs, gracing, graip, graips, graping, grasper, grasps, grike, griped, gripper, grips and grippleness

Whats the definition of گرفت?

Definition of the گرفت are

  • impose or inflict forcefully
  • fasten or fix with a clamp
  • a device (generally used by carpenters) that holds things firmly together
  • a collection of things or persons to be handled together
  • a coupling that connects or disconnects driving and driven parts of a driving mechanism
  • a number of birds hatched at the same time
  • a tense critical situation
  • the act of grasping
  • affect
  • take hold of; grab
  • hold firmly, usually with one's hands
  • a pedal or lever that engages or disengages a rotating shaft and a driving mechanism
  • a woman's strapless purse that is carried in the hand
  • a dredging bucket with hinges like the shell of a clam
  • a tool consisting of several hooks for grasping and holding; often thrown with a rope
  • the act of engaging in close hand-to-hand combat
  • to grip or seize, as in a wrestling match
  • succeed in doing, achieving, or producing (something) with the limited or inadequate means available
  • understanding of the nature or meaning or quality or magnitude of something
  • get the meaning of something
  • the act of grasping
  • the limit of capability
  • hold firmly
  • an intellectual hold or understanding
  • the act of grasping
  • to render motionless, as with a fixed stare or by arousing terror or awe
  • to grip or seize, as in a wrestling match
  • worker who moves the camera around while a film or television show is being made
  • the friction between a body and the surface on which it moves (as between an automobile tire and the road)
  • the appendage to an object that is designed to be held in order to use or move it
  • a flat wire hairpin whose prongs press tightly together; used to hold bobbed hair in place
  • hold fast or firmly
  • a portable rectangular container for carrying clothes
  • an intellectual hold or understanding
  • have room for; hold without crowding
  • be pertinent or relevant or applicable
  • understanding of the nature or meaning or quality or magnitude of something
  • cause to stop
  • drink alcohol without showing ill effects
  • support or hold in a certain manner
  • contain or hold; have within
  • lessen the intensity of; temper; hold in restraint; hold or keep within limits
  • the act of grasping
  • be capable of holding or containing
  • maintain (a theory, thoughts, or feelings)
  • organize or be responsible for
  • the appendage to an object that is designed to be held in order to use or move it
  • protect against a challenge or attack
  • a cell in a jail or prison
  • a stronghold
  • power by which something or someone is affected or dominated
  • a state of being confined (usually for a short time)
  • time during which some action is awaited
  • the space in a ship or aircraft for storing cargo
  • take and maintain control over, often by violent means
  • keep from departing
  • stop dealing with
  • remain in a certain state, position, or condition
  • have as a major characteristic
  • remain committed to
  • assert or affirm
  • hold the attention of
  • keep from exhaling or expelling
  • aim, point, or direct
  • have or hold in one's hands or grip
  • be the physical support of; carry the weight of
  • cover as for protection against noise or smell
  • secure and keep for possible future use or application
  • have rightfully; of rights, titles, and offices
  • arrange for and reserve (something for someone else) in advance
  • be valid, applicable, or true
  • keep in mind or convey as a conviction or view
  • have or possess, either in a concrete or an abstract sense
  • resist or confront with resistance
  • declare to be
  • to close within bounds, or otherwise limit or deprive of free movement
  • cause to continue in a certain state, position, or activity; e.g., keep clean'
  • (law) a procedure whereby a party to a suit says that a particular line of questioning or a particular witness or a piece of evidence or other matter is improper and should not be continued and asks the court to rule on its impropriety or illegality
  • the speech act of objecting
  • the act of expressing earnest opposition or protest
  • the act of someone who picks up or takes something
  • very attractive; capturing interest
  • the phenomenon of forming chemical bonds
  • (chemistry) a property of atoms or radicals; their combining power given in terms of the number of hydrogen atoms (or the equivalent)
  • (biology) a relative capacity to unite or react or interact as with antigens or a biological substrate
  • a serious examination and judgment of something
  • a written evaluation of a work of literature
  • disapproval expressed by pointing out faults or shortcomings
  • acute abdominal pain (especially in infants)
  • acute abdominal pain (especially in infants)
  • capable of arousing and holding the attention
  • the appendage to an object that is designed to be held in order to use or move it
  • touch, lift, or hold with the hands
  • interact in a certain way
  • handle effectively
  • act on verbally or in some form of artistic expression
  • show and train
  • a strand or cluster of hair
  • keep engaged
  • a restraint incorporated into the ignition switch to prevent the use of a vehicle by persons who do not have the key
  • hold in a locking position
  • become engaged or intermeshed with one another
  • any wrestling hold in which some part of the opponent's body is twisted or pressured
  • a fastener fitted to a door or drawer to keep it firmly closed
  • a mechanism that detonates the charge of a gun
  • become rigid or immoveable
  • place in a place where something cannot be removed or someone cannot escape
  • fasten with a lock
  • build locks in order to facilitate the navigation of vessels
  • hold fast (in a certain state)
  • pass by means through a lock in a waterway
  • enclosure consisting of a section of canal that can be closed to control the water level; used to raise or lower vessels that pass through it
  • the act of gripping something firmly with the hands (or the tentacles)
  • small stuff that is used for lashing two or more ropes together
  • ہائیڈروجن کے ایک یا زیادہ جوہروں سے ترکیب

What is the synonym of گرفت?

Synonym of word گرفت are پٹی, پتر جُڑ جانا یا لگنا, شکنجہ, گرفت, پکڑنا, قبضہ کرنا, مُوٹھ, چنگل, پنجہ, قبضہ

What are the idioms related to گرفت?

Here are the idioms that are related to the word گرفت.

  • Gold opens all lock no lock will hold against the power of gold
  • Criticism is easy and art is difficult
  • To grapple with
  • To lose one grip
  • To lose one s grip