laag - لاگ meanings in English
laag - لاگ meanings in English are grudge, trick, relevancy, relation, plot, love, intrigue, ill feeling, correlation, attachment, antagonism, animosity, affinity, affection, tax, hostility, logge laag - لاگ in English. More meanings of laag - لاگ, it's definitions, example sentences, related words, idioms and quotations.
grudge trick relevancy relation plot love intrigue ill feeling correlation attachment antagonism animosity affinity affection tax hostility logge
laag - لاگ Definitions
Please find 62 English and 2 Urdu definitions related to the word laag - لاگ.
- (noun) : a positive feeling of liking
- (noun) : (anthropology) kinship by marriage or adoption; not a blood relationship
- (noun) : a statistical relation between two or more variables such that systematic changes in the value of one variable are accompanied by systematic changes in the other
- (noun) : a reciprocal relation between two or more things
- (noun) : a statistic representing how closely two variables co-vary; it can vary from -1 (perfect negative correlation) through 0 (no correlation) to +1 (perfect positive correlation)
- (noun) : violent action that is hostile and usually unprovoked
- (noun) : the feeling of a hostile person
- (noun) : a state of deep-seated ill-will
- (noun) : a hostile (very unfriendly) disposition
- (verb) : use to the limit
- (noun) : charge against a citizen's person or property or activity for the support of government
- (verb) : levy a tax on
- (verb) : set or determine the amount of (a payment such as a fine)
- (verb) : make a charge against or accuse
- (noun) : a feeling of ill will arousing active hostility
- (noun) : a state of deep-seated ill-will
- (noun) : (biochemistry) interference in or inhibition of the physiological action of a chemical substance by another having a similar structure
- (noun) : an actively expressed feeling of dislike and hostility
- (noun) : the relation between opposing principles or forces or factors
- (noun) : faithful support for a cause or political party or religion
- (noun) : the act of attaching or affixing something
- (noun) : the act of fastening things together
- (noun) : a supplementary part or accessory
- (noun) : a connection that fastens things together
- (noun) : a writ authorizing the seizure of property that may be needed for the payment of a judgment in a judicial proceeding
- (noun) : a feeling of affection for a person or an institution
- (verb) : form intrigues (for) in an underhand manner
- (verb) : cause to be interested or curious
- (noun) : a crafty and involved plot to achieve your (usually sinister) ends
- (noun) : a clandestine love affair
- (verb) : have sexual intercourse with
- (verb) : get pleasure from
- (noun) : a beloved person; used as terms of endearment
- (noun) : any object of warm affection or devotion
- (noun) : a deep feeling of sexual desire and attraction
- (noun) : sexual activities (often including sexual intercourse) between two people
- (noun) : a strong positive emotion of regard and affection
- (noun) : a score of zero in tennis or squash
- (verb) : have a great affection or liking for
- (verb) : be enamored or in love with
- (noun) : a secret scheme to do something (especially something underhand or illegal)
- (noun) : a small area of ground covered by specific vegetation
- (verb) : make a schematic or technical drawing of that shows interactions among variables or how something is constructed
- (noun) : the story that is told in a novel or play or movie etc.
- (verb) : make a plat of
- (noun) : a chart or graph showing the movements or progress of an object
- (verb) : plan secretly, usually something illegal
- (verb) : devise the sequence of events in (a literary work or a play, movie, or ballet)
- (noun) : an act of narration
- (noun) : an abstraction belonging to or characteristic of two entities or parts together
- (noun) : (usually plural) mutual dealings or connections among persons or groups
- (noun) : (law) the principle that an act done at a later time is deemed by law to have occurred at an earlier time
- (noun) : a person related by blood or marriage
- (noun) : sexual activity between individuals, especially the insertion of a man's penis into a woman's vagina until orgasm and ejaculation occur
- (noun) : the relation of something to the matter at hand
- (noun) : an illusory feat; considered magical by naive observers
- (verb) : deceive somebody
- (noun) : a prostitute's customer
- (noun) : a cunning or deceitful action or device
- (noun) : an attempt to get you to do something foolish or imprudent
- (noun) : a period of work or duty
- (noun) : (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- وہ کیمیائی قُوَّت جو مالی کیول میں ایٹموں کو یکجا رکھتی ہےمشابہت
- ایک ایسا عدد جو دو مُختَلِف انواع کے اعداد کے درمیان تعلَّق کا قرب ظاہِر کرے
More words related to the meanings of laag - لاگ
More words from English related to laag - لاگ
View an extensive list of words below that are related to the meanings of the word laag - لاگ meanings in English in English.
accompanimentconditioneventstanceaccountaffectionmoodnarrativenatureparticularspositionpostureprospectqualityremarkreportsituationstatestatementstoryaculusbarbthorncocksspurgrudgepricklethistleneeddemanddesirelikinglonginglovenecessityurgencyvolitionwantwellwishingyearningardourenthusiasm enthusiasmsadherepantroughlaggenkissamourcaress ... fondnessadorablenessadoredadoringaffablenessaffectionalaffinelovagelovingnessadoresaffearaffeardaffearingaffearsaffectionsaffichesafforceafforcedafforcesafforcingaffordingaffordscovinglovageslovingsendearednessrovingnessfiendgeniuslemuresmanesmisacceptationphantomphantomsspecteraffectationghostspookphantomyhaunceattachmentfriendshipkindnessjointurebullacachetchopimpresssealstampsunserailmohrfamiliaritywooingloveredaffianceaffiliationengagementimputationrapportaffinitybetrothalcomparisoncorrelationproportionratioregardingrelationlinealityappertainco operationconcernkinkindredcontactconnectionconnectednessconsiderationlinklinkagenexusrelatednessrelativenessconnexionliaisoncollaborationcoalitionscommunionparticipationsubscriptionglamorgravitationhomologyosculationsimilitudeanalogylikenessidenticalnessresemblanceunsimilarityoutmatchedsmatchedsmatchesassimilabilitydisassimilationsimilarykinsmanshipdividendfellowship numeratoranasconcatenationconcordancebondcoherencecohesionconsistencycontiguityconningslinkagesconsanguinitykinshipkinshipskinswomenaffluxtendencyinclinationpenchantpredilectionpredispositionpreferenceproclivitypropensitytrendtendancetendentialtreaguetrendinesstregetappetitesmindednesspropendencyardent desirestrong desirehabitudeinducementpleasurewishalluresalureobdurenessagistgeldlevytaxapologuefolkloretalelegendmarchenplotsagayarnanecdoticanecdoticaltaeltalebearinganecdotagestoryingtalegallatalegallastalertalesmentelluraldiocese districtmanorseigniorytenureareabearingcircleholdingjurisdictionlocalityprovinceregionrelevancyterritoryzonezonuleparvenueterrineterraneterritterreityterritoriedapplicabilityapplicationrelationshipputureattaminatelabentartfulnessmachinationmakepreposterousruseslinesscreationdeceitinstinctintriguesagacitywisdominherencyinnatenessnaturismnatalitiesnatiformnaturesconnaturalityconnaturalnessnaturalitynaturelessnaturitychouscross biteguilehoaxhypocrisyillusionimposturejugglelegerdemainshamcheatingdeceivingdeceptiondouble dealingfallowfraudgriftjuggleryliemountebankerynetspooftricktrickerywilewilfulnessdelusivewilefuldecededecencedesudationbadinagedisport fungaietyjestjokerailleryamusementdiversion larkmirthfulnessyakamusingamusinglyindulgentlybandagecompressfarmgirthligamenligaturetableteachingbandbeltclampdeligationeye washheadbandinklekerseylathlinelistpartplasterrandribbonrowscreedstrapstripstripetabtapethongstipestreepputtistripierstripingsstroutyirdedpateestrippetstryphnicbroilcorruptiondiscordfracasmischiefruckustainttermagancybrawldissension disturbancehorrorinequityinsurgencykick upmeleemischievousnessoutbreakquarrelrebellionriotseditionstrifeviolencewickednessriotryriotisecaptivatecharmdeludefascinateglamourceremonialcraftgadgetmanoeuvremotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomfashiongaitgimmickryindirectionshenaniganstratagemtacticwalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackcheatfeint gimmickmiragemisconceitmisgivingmisguidancemisrepresentationmistakecatchdelusionfallacyimpositionjapecircumlocutiondifferenceturningwindingcommonfang femalehostilityjujubewaranimosityanimusantagonismdespiteenmityill willinimicalitymalevolencemalicemalignityvengeancebarrebermsberriesconfederacyconspiracymisalliancecabalcollusioncomplotconcordmanipulationconcupiscenceconspectusintriguerintriganteconspersionconspicuityconspissationconspireleaguemachinatecolludeframe upconspiringplotteringplottingconcoctersconcoctorscustomsdutyfreight impostscattarifftaxationtollyieldrevenuesgrainageland rentlagandalliancecandourpurityselfless worshipsinceritydiddlehoodwinkinghypelurchmisgivemisleadoutwitswindlebafflebamboozlebefoolbeguilebilkbumbazebunkchicanecogdeceivedefrauddodgedupefoolfoxfudgegyphoodwinkjockeynobbleshortshortchangedilly dallyveg outdisagreementdissimilarityoppugnancyoppositionantithesiscontrarinessreversalsyzygyopponencyoppletionopposabilityopposaloppositisepalousoppugnationcoildilemmafoldindirectnessmazemisfortunerevolutiontorsionturntwistyawndustybad blooddustimpurityrancourvexationhazeemulationenvyjealousyspiteheart burningenviousnessjalousiedjealousiesennationenvynedjealoushoodjealousnessmalignancyspitefulnessaggressiongallhatredpiqueadiposityantinomyantonymyantrorsedovishnessenamorednesslividnessantitheismantliatedewinesseudaemonyfideismreestysectilityalacriousnessalienabilityalimentarinessaltiloquenceanacanthousanimoseantheriferousantiattritionantichristianityanticnessantisepalousantitypousantitypydelitescencydisassiduitydisplicencefidejussioninimicitiousinimicousinmacyrevalescenceerotomaniainfatuationmaniapassionromancehumbuginsincerityquizfeloniousfirelustangerbaleflameincensementfaeryfiacresfiresfirryfirefishflare upfuriousnesshuffirritancyirritationmiffprovocationsanxietyfitfurygriefindignationinfuriationrageteentemperwaxangrinessangersblousingindignancefriendlygabblegrowlgrumblemufflemumblemutterprattlecacklehumjabbermurmuradumbratemurmuringrave upravelingbuggeringravedravelmentsaggroupingchargerevenueevictiongavelhomagetributegrudegeenravishennuyingenvyingenbibeenvieanimismanimisticantisemitismhostilitiesdecemviralenmitieshermitessrivaliserivalisesrivalityrivalriesrivalshiprivalshipsriveryvitiosityanimosenessanimousantichronismantistrumaticenmistfoehoodmeridionalityprimityraclenesshatevindictivenesspennilessnessirregenerationrhemishobduracyanemonypretextdevicedisguise excusequibbletrepanhocusilliberalityniggardlinessstinglessbucellasesstingierstingiestimplantationintimacyrivalryvendettajugglingsleightjuxtapositionaccessibilityclosenessnearnesspropinquityproximityvicinityproxyshipkindlinessmildnesspitypropitiousnesscompassionfavourmercycompassionatenessloving kindnessmercifulnessshittlenessalliancechainlineagestringthreadlugcandle flameexpectationhopelooloughlulowemakingmixturesynthesiscompositionconfigurationconstructiondecoctioninventionmethodmodeplanrecipesyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismmanipulatecontrivancemanipulablemaniplesmanipularmanipulatedmanipulatingmanipulatorywaitinningopportunitymurderambushartificemulctwaistkirdamagefine penaltyransomoverturetabulatesginprojectproposalrecommendationschemesuggestionpropositussuggestibilitydiscommendpreposedpropensionpropinespropiningproposestipsifyingdiscommendationpresupposalpropicepropinationsuggestmentprogramconcotiondemarcheprogrammegenus taxustaxustackstaxametertaxationstaxestaxingstechstexterrainpatchdisputetumultaccuseascribeimputeadherenceadmirationairscoquetryflirtingpretenceswaggerfaithdevoutnessdevotementdevotionsdevitationdevotionalityappetitecravinghankeringurgewannaaffraybattleclashcombatconflictcontentioncontestfightfrayhasslewranglewranglingwrestlingbackbitingcunningnessslynessbeguilementlosschacmachastenpunishcoaxinveigleseduceclevernessdabmopseductionmagicmiracleevasion frictiongashhackfelwortbegloomingpersecutionslandersophistrypursescrotumtesticle
Idioms related to the meaning of laag - لاگ
What are the meanings of laag - لاگ in English?
Meanings of the word laag - لاگ in English are affection, affinity, correlation, grudge, hostility, tax, animosity, antagonism, attachment, intrigue, love, plot, relation, relevancy, trick, logge and ill feeling. To understand how would you translate the word laag - لاگ in English, you can take help from words closely related to laag - لاگ or it’s English translations. Some of these words can also be considered laag - لاگ synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word laag - لاگ. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use laag - لاگ in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say laag - لاگ in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of laag - لاگ with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by لاگ?
Meanings of لاگ are affection, affinity, correlation, grudge, hostility, tax, animosity, antagonism, attachment, intrigue, love, plot, relation, relevancy, trick, logge and ill feeling
Whats the definition of لاگ?
Definition of the لاگ are
- a positive feeling of liking
- (anthropology) kinship by marriage or adoption; not a blood relationship
- a statistical relation between two or more variables such that systematic changes in the value of one variable are accompanied by systematic changes in the other
- a reciprocal relation between two or more things
- a statistic representing how closely two variables co-vary; it can vary from -1 (perfect negative correlation) through 0 (no correlation) to +1 (perfect positive correlation)
- violent action that is hostile and usually unprovoked
- the feeling of a hostile person
- a state of deep-seated ill-will
- a hostile (very unfriendly) disposition
- use to the limit
- charge against a citizen's person or property or activity for the support of government
- levy a tax on
- set or determine the amount of (a payment such as a fine)
- make a charge against or accuse
- a feeling of ill will arousing active hostility
- a state of deep-seated ill-will
- (biochemistry) interference in or inhibition of the physiological action of a chemical substance by another having a similar structure
- an actively expressed feeling of dislike and hostility
- the relation between opposing principles or forces or factors
- faithful support for a cause or political party or religion
- the act of attaching or affixing something
- the act of fastening things together
- a supplementary part or accessory
- a connection that fastens things together
- a writ authorizing the seizure of property that may be needed for the payment of a judgment in a judicial proceeding
- a feeling of affection for a person or an institution
- form intrigues (for) in an underhand manner
- cause to be interested or curious
- a crafty and involved plot to achieve your (usually sinister) ends
- a clandestine love affair
- have sexual intercourse with
- get pleasure from
- a beloved person; used as terms of endearment
- any object of warm affection or devotion
- a deep feeling of sexual desire and attraction
- sexual activities (often including sexual intercourse) between two people
- a strong positive emotion of regard and affection
- a score of zero in tennis or squash
- have a great affection or liking for
- be enamored or in love with
- a secret scheme to do something (especially something underhand or illegal)
- a small area of ground covered by specific vegetation
- make a schematic or technical drawing of that shows interactions among variables or how something is constructed
- the story that is told in a novel or play or movie etc.
- make a plat of
- a chart or graph showing the movements or progress of an object
- plan secretly, usually something illegal
- devise the sequence of events in (a literary work or a play, movie, or ballet)
- an act of narration
- an abstraction belonging to or characteristic of two entities or parts together
- (usually plural) mutual dealings or connections among persons or groups
- (law) the principle that an act done at a later time is deemed by law to have occurred at an earlier time
- a person related by blood or marriage
- sexual activity between individuals, especially the insertion of a man's penis into a woman's vagina until orgasm and ejaculation occur
- the relation of something to the matter at hand
- an illusory feat; considered magical by naive observers
- deceive somebody
- a prostitute's customer
- a cunning or deceitful action or device
- an attempt to get you to do something foolish or imprudent
- a period of work or duty
- (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- وہ کیمیائی قُوَّت جو مالی کیول میں ایٹموں کو یکجا رکھتی ہےمشابہت
- ایک ایسا عدد جو دو مُختَلِف انواع کے اعداد کے درمیان تعلَّق کا قرب ظاہِر کرے
What is the synonym of لاگ?
Synonym of word لاگ are چاہ, لگن, پیار, پریت, پیت, پریم, سنیہ, نیہ, مہر, الفت
What are the idioms related to لاگ?
Here are the idioms that are related to the word لاگ.
- Relationship leads to ill feeling
- Plot proof
- A good friend is my nearest relation
- In relation to
- In relation to