Dhoka deyba - دھوکا دینا meanings in English
Dhoka deyba - دھوکا دینا meanings in English are diddle, cog, deceive, defraud, delude, dodge, dupe, fool, fox, fudge, gyp, hoodwink, jockey, nobble, short, shortchange, trick, chicane, cheat, hoax, hoodwinking, hype, lie, lurch, misgive, mislead, outwit, swindle, baffle, bamboozle, befool, beguile, bilk, bumbaze, bunk, wile Dhoka deyba - دھوکا دینا in English. More meanings of dhoka deyba - دھوکا دینا, it's definitions, example sentences, related words, idioms and quotations.
diddle cog deceive defraud delude dodge dupe fool fox fudge gyp hoodwink jockey nobble short shortchange trick chicane cheat hoax hoodwinking hype lie lurch misgive mislead outwit swindle baffle bamboozle befool beguile bilk bumbaze bunk wile
Dhoka deyba - دھوکا دینا Definitions
Please find 128 English and 3 Urdu definitions related to the word Dhoka deyna - دھوکا دینا.
- (noun) : a flat plate that controls or directs the flow of fluid or energy
- (verb) : be a mystery or bewildering to
- (verb) : hinder or prevent (the efforts, plans, or desires) of
- (verb) : restrain the emission of (sound, fluid, etc.)
- (noun) : a rough bed (as at a campsite)
- (noun) : a long trough for feeding cattle
- (noun) : unacceptable behavior (especially ludicrously false statements)
- (noun) : a bed on a ship or train; usually in tiers
- (noun) : beds built one above the other
- (noun) : a message that seems to convey no meaning
- (verb) : provide with a bunk
- (verb) : avoid paying
- (verb) : flee; take to one's heels; cut and run
- (noun) : a deception for profit to yourself
- (noun) : the act of swindling by some fraudulent scheme
- (noun) : someone who leads you to believe something that is not true
- (noun) : weedy annual native to Europe but widely distributed as a weed especially in wheat
- (noun) : weedy annual grass often occurs in grainfields and other cultivated land; seeds sometimes considered poisonous
- (verb) : deprive somebody of something by deceit
- (verb) : engage in deceitful behavior; practice trickery or fraud
- (verb) : be sexually unfaithful to one's partner in marriage
- (verb) : defeat someone through trickery or deceit
- (verb) : raise trivial objections
- (noun) : a bridge hand that is void of trumps
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (verb) : defeat someone through trickery or deceit
- (noun) : a movable barrier used in motor racing; sometimes placed before a dangerous corner to reduce speed as cars pass in single file
- (noun) : tooth on the rim of gear wheel
- (verb) : join pieces of wood with cogs
- (verb) : roll steel ingots
- (noun) : a subordinate who performs an important but routine function
- (verb) : manipulate manually or in one's mind or imagination
- (verb) : fool or hoax
- (noun) : a person who is tricked or swindled
- (verb) : fool or hoax
- (verb) : spend frivolously and unwisely
- (noun) : a person who lacks good judgment
- (noun) : a professional clown employed to entertain a king or nobleman in the middle ages
- (verb) : make a fool or dupe of
- (verb) : indulge in horseplay
- (verb) : be confusing or perplexing to; cause to be unable to think clearly
- (noun) : alert carnivorous mammal with pointed muzzle and ears and a bushy tail; most are predators that do not hunt in packs
- (noun) : a member of an Algonquian people formerly living west of Lake Michigan along the Fox River
- (noun) : English religious leader who founded the Society of Friends (1624-1691)
- (noun) : English statesman who supported American independence and the French Revolution (1749-1806)
- (noun) : a shifty deceptive person
- (verb) : become discolored with, or as if with, mildew spots
- (verb) : deceive somebody
- (noun) : the Algonquian language of the Fox
- (noun) : the grey or reddish-brown fur of a fox
- (noun) : something intended to deceive; deliberate trickery intended to gain an advantage
- (verb) : subject to a playful hoax or joke
- (verb) : publicize in an exaggerated and often misleading manner
- (noun) : someone employed to ride horses in horse races
- (noun) : an operator of some vehicle or machine or apparatus
- (verb) : compete (for an advantage or a position)
- (verb) : defeat someone through trickery or deceit
- (verb) : ride a racehorse as a professional jockey
- (verb) : originate (in)
- (noun) : a statement that deviates from or perverts the truth
- (noun) : position or manner in which something is situated
- (noun) : Norwegian diplomat who was the first Secretary General of the United Nations (1896-1968)
- (verb) : be located or situated somewhere; occupy a certain position
- (verb) : have a place in relation to something else
- (verb) : be and remain in a particular state or condition
- (verb) : tell an untruth; pretend with intent to deceive
- (verb) : be lying, be prostrate; be in a horizontal position
- (verb) : assume a reclining position
- (verb) : walk as if unable to control one's movements
- (noun) : an unsteady uneven gait
- (noun) : abrupt up-and-down motion (as caused by a ship or other conveyance)
- (noun) : a decisive defeat in a game (especially in cribbage)
- (verb) : move slowly and unsteadily
- (verb) : defeat by a lurch
- (verb) : move abruptly
- (verb) : suggest fear or doubt
- (verb) : lead someone in the wrong direction or give someone wrong directions
- (verb) : give false or misleading information to
- (adverb) : quickly and without warning
- (adjective satellite) : marked by rude or peremptory shortness
- (noun) : the location on a baseball field where the shortstop is stationed
- (noun) : accidental contact between two points in an electric circuit that have a potential difference
- (verb) : cheat someone by not returning him enough money
- (adjective) : primarily temporal sense; indicating or being or seeming to be limited in duration
- (adjective) : not holding securities or commodities that one sells in expectation of a fall in prices
- (adjective satellite) : lacking foresight or scope
- (adjective) : (of memory) deficient in retentiveness or range
- (adjective) : low in stature; not tall
- (adverb) : at a disadvantage
- (adverb) : so as to interrupt
- (adverb) : at some point or distance before a goal is reached
- (adverb) : clean across
- (adverb) : without possessing something at the time it is contractually sold
- (adverb) : in a curt, abrupt and discourteous manner
- (noun) : the fielding position of the player on a baseball team who is stationed between second and third base
- (verb) : create a short circuit in
- (adjective satellite) : tending to crumble or break into flakes due to a large amount of shortening
- (adjective) : (primarily spatial sense) having little length or lacking in length
- (adjective) : of speech sounds or syllables of relatively short duration
- (adjective satellite) : of insufficient quantity to meet a need
- (noun) : the act of swindling by some fraudulent scheme
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (verb) : fool or hoax
- (verb) : make a fool or dupe of
- (verb) : hinder or prevent (the efforts, plans, or desires) of
- (verb) : evade payment to
- (verb) : cheat somebody out of what is due, especially money
- (verb) : cause someone to believe an untruth
- (verb) : be false to; be dishonest with
- (verb) : be false to; be dishonest with
- (noun) : a statement that evades the question by cleverness or trickery
- (noun) : an elaborate or deceitful scheme contrived to deceive or evade
- (noun) : a quick evasive movement
- (verb) : make a sudden movement in a new direction so as to avoid
- (verb) : move to and fro or from place to place usually in an irregular course
- (noun) : soft creamy candy
- (verb) : tamper, with the purpose of deception
- (noun) : (sometimes offensive) an act of swindling or cheating
- (verb) : (sometimes offensive) to cheat or swindle
- (verb) : take away to an undisclosed location against their will and usually in order to extract a ransom
- (verb) : disable by drugging
- (noun) : an illusory feat; considered magical by naive observers
- (verb) : deceive somebody
- (noun) : a prostitute's customer
- (noun) : a cunning or deceitful action or device
- (noun) : an attempt to get you to do something foolish or imprudent
- (noun) : a period of work or duty
- (noun) : (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- جَہاز يا کَمرے ميں ديوار سے لَگا ہُوا سونے کے لِيے تَختَہ
- کِسی شے کو ضرورت سے زیادہ بڑھاوا دینا
- فریب یا حکمت عملی سے مغلوب کرنا
More words from English related to Dhoka deyna - دھوکا دینا
View an extensive list of words below that are related to the meanings of the word Dhoka deyba - دھوکا دینا meanings in English in English.
abducemisdirectmisguidemisleadbeguilebluffdepravewronglead astrayleading astraymislikingmisplayingabruptlyfortuitouslyoccasioallyabruptall of a suddenferlypreruptshortsuddensuddenlyunexpectedof a suddensnap atsuddennessachinglyhuddenruddilysnappinglyyerkedachronicabridgedbriefdiminishedmonosyllabicteenyconcisecurtailedlaconicsummarisedtersebriefnessbriefsdebriefsnutshellsshortingshortyshortwingaffectation ... emblazonrygarishnessgaudinesspreviewsideshowbunkdisplayloudnessshowshowingsightspectaclecounterdemonstrationexhibitionexhibitionismexposittopographyexhibitedexhibitingexhibitoryexhibitsexposalsexposuresshowcasedshowcasingbeshiningtablementpharisaismclaptraphypocrisyinsincerityostentationplausibilityappearanceartfulnesschouscross biteguilehoaxillusionimposturejugglelegerdemainruseshamcheatingdeceitdeceivingdeceptiondouble dealingfallowfraudgriftjuggleryliemountebankerynetspooftricktrickerywilewilfulnessdelusivewilefuldecededecencedesudationcheatcircumventionfeint huskartlesscredulousdupeerrant gulliblenaivesimpletoncutesacklessavertbaffleobviatestopwarddelaydodgeignorepostponeavertingavocetcoaxenticenameoverpersuadedeludeinveigleseducerdefrayedestrayedestrayinginduviateseducementseducingstruntingsuppeditationbamboozlebandagecompressfarmgirthholdingligamenligaturetableteachingtenurebandbeltclampdeligationeye washheadbandinklekerseylathlinelistpartplasterpositionrandribbonrowscreedstrapstripstripetabtapethongzonestipestreepputtistripierstripingsstroutyirdedpateestrippetstryphnicbawdcutpimpdisjoin go betweenslink awaythrashblindbefooldefraudblunderheadgabygreenhornstupidasinineclotdoltdonkeydrabdullfoolgandergawkishgoofgoofygoongoophalf wittedidiotimprudentinaneinsensatejackassmindlessmoonymulishmuttnincompoopoafoafishwitlesswoodenzanybelatedlyblollydaftnessevasivelyunlovelybefooledbelaboredbractlessidiolectsmanelesspraiselesswitelessbebloodydisrulydisslanderousexorhizousexortivefool bornfool happyfool hastyfool largefool largessefoolhardihoodfoolhardilyfraudlessfrownymanlesslypretenselessblearyempty headedgawkyhumdrumidotlubberlylunaticpig headedshallow brainedfoolhardinessidiographicidiopathicfoolsgoofilygoofinessidioticalidioticonsidiotishidiotsstupedstupentstupiderstupideststupidnessstupidsstupingstupratestupratedstupratesstupratingstuprationfoolfishidiocraticidiocraticalidiophanousidiotryspumiferousbullockgratuitypurfletaurusvinescreeperoxspadebeloxenbullocksbullskellsvinealbullcaptivatecharmfascinateglamourintrigueceremonialcraftgadgetmachinationmanoeuvremotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomfashiongaitgimmickryindirectionshenaniganstratagemtacticwalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackedge flexionforcing pumptagtailwhiffbrawnbreathcourageendenergyextremitygutheftimpetusinertiainstantlifemightmomentpneumatailtempertugvitalityzaptailletrapgimmickmiragemisconceitmisgivingmisguidancemisrepresentationmistakecatchdelusionfallacyimpositionjapeblackmailbullyinghighhandednessbullarycheckobstructblanketblockcumberdeterhobbleimpedeinterferethwarttriginterrupterchicanecounterfeitfakefalsifyfalsifyingforisfamiliatebetrayaldouble crossciaptraplucencybrightnessglitterglosssplendourtwizzletwizzlingluster lustrewaterdiversion duplicityhoodwinkingsophistryburnscircumventcircumlocutiondifferenceturningwindingconfute gammonoutwitcontaminationdraff falsehoodfeignedlyhumbuglyingbragfalsification fictioninveracitymendacityuntruthfalsenessuntruthfulnessfalsehoodsliegedomliegeslieslieusuntruthsfalnessliascouchlairlatinaefixlightreposerestunbendresittingrestatingrestringrestylingcoggearreelcrazydriveller madmadmanmaniacphreneticrabidcrackerscrackpotdeliriousdementdementedderangeddippydistressedfoolishhalf bakedinsanekooklocoloonymadcapmoronicnutssillywackywhackycrazedcrazilycrazyweedmadakemaddenedmaniocamankyobsessedcraziercraziescraziestinsanestinsaniemadbrainmadcapsmaddedmaddersmaddestmaddingmadgemadlingsphreniticrabicstoutishmanihocdiddlestaggervacillatewabblewagtittertottertremblewaverwobblewaveringsscuffstumblefalter to be intoxicatedstammertitubatescumblestagheadscumblesscumblingstaggardsswindlefartdawdleidlepottertruckdiminutivelimitedjuniornarrowsmallstuntedjuniorslesslesserlittleminorminimicropigmeanpimpingskimpyyoungerbusboycommoninconsequentiallowmeagremeanmidgetminutepaltrypettypottysmallishtinywingletyoungabridgerminaciousscincidsissifiedsmallersmalleytrivalentundersizedabatedamissingchordeechotachuddahexscindingmiffiestminifiedpattlescailedscantingscantledscrimpedshoredshortedshortersmalledsmalmedtaivertiddleytiddliertiddliesttinfultoddledtrifledtriflinglytruncaltruncatelytruncatesudderfulunderdidminatoriallyminatorilymissificatescintillousshorlaceoussmaltinetrifalloweddisbelieverdishonestfaithlessfraudulentimmoralshonkyjacklegnefariousnullifidianperfidiousunconscionableunfairunfaithfulunprincipledwide boydiscomfiture erfestoonfoilfrustrationgarlandnecklaceoverthrowroutcheckmatedefeatfatiguelosslurchsurrenderwhippingwreathhaarloselsnecklacesnecklacedrascalmalpractitionerunreliabledissembling guilefulillusiveimpostorknavishriggershiftybamboozlercunningdeceitfuldeceiverdodgerdodgygnosticillusoryimposterinsidiousinsinceremisleadermountebankspurioustrickstertrickywilfulfreebeecirclecoildilemmafoldindirectnessmazemisfortunerevolutiontorsionturntwistyawndistractbewildermopenumskullboorclodclownlambmannerlessnoodlenumbskullduffermomenaturalnerdputwant witblock headboneheadboobycuckoodensegagajayknuckle headmoronnitwitnuttyvacuouszombiestuporouscoxcombflat gawkverdantfoolingfoolifystupifydwarfedgullvictimizejockeyundersizevictimiseembezzlemisappropriatedefalcategibeharrymoochpillageplunderembezzlingignorantessence fundamentalrootbasefoundation rhizomerootagerooterrootlerootyfablefeignframemalleatemanufacturefabricateforgefudgeinventtrumpvamppitchappearbetidedrop encampenterfallhappenmediatesitsleepstaysuffersuitintracranialfaultinessknaverymischiefmischievousnessnaughtinesspranktermagancywaggerywaggishnessbalebamimpishnessknavishnessquizrigvicevillainywickednessgypfalsityshammershifterfelonmendaciousdeceiversdeludersflounceginmaraudoverrunwallowdepredateextortfleeceflounderforagelollreturnrifleriotrobsprawlwringdisplumeloavinglootenrewoundrobbingrevertentrevocateredoundingfoxfawkesficusfucusfocifucusesficoesfrayexcoriategrudgehostilitytaxaffectionaffinityanimosityantagonismattachmentcorrelationill feelingloveplotrelationrelevancyloggepretextdevicedisguise excusequibbletrepanhocuswheedlemake believejiltpalaverbrewdeceivehoodwinkprofitbenefituseutilisebeneficiateleveragingto advantageavailingavisingavizingadvantaginghypejerkjogjoltrough riderjugglingsleightprevaricatelying inliaisinglyinglymisrepresentmisstatemistellwelshlurecajoleinciteinstigatepromptseducetemptmakemakingmixturenaturesynthesiscompositionconfigurationconstructiondecoctioninventionmethodmodeplanrecipesyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismmanipulateconspiremachinatewaitinningopportunitymurderambushartificemisgivesmell the ratforgetunlearnmomentaryoutdosurpassovertirevanquishwalk offoversetbumbazeconfoundseductiontemptationdivagationinstigationstultifystultifiedjivetergiversateairscoquetryflirtingpretenceswaggeravoidforbearpalterstand offlevantingobturatingtazzeaffatuatebatteringcaningcudgellinghidingpoundingbeguilementdamagechacmabotchbungledishonourflatterclevernessnotchdabmopmagicmiracledeluderquackencumber imposedevourevadeevasion frictionexpectationsuspensewaitingawawaitingsvixenfox trotfoxilyfoxberriesfoxedfoxesfoxingfoxingsfoxshipfoxeryfoxishfoxlygashhackrheaenobbleshortchangebelaudingbetrayingbetraysscourage
Idioms related to the meaning of Dhoka deyba - دھوکا دینا
What are the meanings of Dhoka deyba - دھوکا دینا in English?
Meanings of the word Dhoka deyba - دھوکا دینا in English are . To understand how would you translate the word Dhoka deyba - دھوکا دینا in English, you can take help from words closely related to Dhoka deyba - دھوکا دینا or it’s English translations. Some of these words can also be considered Dhoka deyba - دھوکا دینا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Dhoka deyba - دھوکا دینا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Dhoka deyba - دھوکا دینا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Dhoka deyba - دھوکا دینا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Dhoka deyba - دھوکا دینا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by dhoka deyba?
diddle, cog, deceive, defraud, delude, dodge, dupe, fool, fox, fudge, gyp, hoodwink, jockey, nobble, short, shortchange, trick, chicane, cheat, hoax, hoodwinking, hype, lie, lurch, misgive, mislead, outwit, swindle, baffle, bamboozle, befool, beguile, bilk, bumbaze, bunk, wile
Whats the definition of dhoka deyba?
Definition of the dhoka deyba are
- a flat plate that controls or directs the flow of fluid or energy
- be a mystery or bewildering to
- hinder or prevent (the efforts, plans, or desires) of
- restrain the emission of (sound, fluid, etc.)
- a rough bed (as at a campsite)
- a long trough for feeding cattle
- unacceptable behavior (especially ludicrously false statements)
- a bed on a ship or train; usually in tiers
- beds built one above the other
- a message that seems to convey no meaning
- provide with a bunk
- avoid paying
- flee; take to one's heels; cut and run
- a deception for profit to yourself
- the act of swindling by some fraudulent scheme
- someone who leads you to believe something that is not true
- weedy annual native to Europe but widely distributed as a weed especially in wheat
- weedy annual grass often occurs in grainfields and other cultivated land; seeds sometimes considered poisonous
- deprive somebody of something by deceit
- engage in deceitful behavior; practice trickery or fraud
- be sexually unfaithful to one's partner in marriage
- defeat someone through trickery or deceit
- raise trivial objections
- a bridge hand that is void of trumps
- the use of tricks to deceive someone (usually to extract money from them)
- defeat someone through trickery or deceit
- a movable barrier used in motor racing; sometimes placed before a dangerous corner to reduce speed as cars pass in single file
- tooth on the rim of gear wheel
- join pieces of wood with cogs
- roll steel ingots
- a subordinate who performs an important but routine function
- manipulate manually or in one's mind or imagination
- fool or hoax
- a person who is tricked or swindled
- fool or hoax
- spend frivolously and unwisely
- a person who lacks good judgment
- a professional clown employed to entertain a king or nobleman in the middle ages
- make a fool or dupe of
- indulge in horseplay
- be confusing or perplexing to; cause to be unable to think clearly
- alert carnivorous mammal with pointed muzzle and ears and a bushy tail; most are predators that do not hunt in packs
- a member of an Algonquian people formerly living west of Lake Michigan along the Fox River
- English religious leader who founded the Society of Friends (1624-1691)
- English statesman who supported American independence and the French Revolution (1749-1806)
- a shifty deceptive person
- become discolored with, or as if with, mildew spots
- deceive somebody
- the Algonquian language of the Fox
- the grey or reddish-brown fur of a fox
- something intended to deceive; deliberate trickery intended to gain an advantage
- subject to a playful hoax or joke
- publicize in an exaggerated and often misleading manner
- someone employed to ride horses in horse races
- an operator of some vehicle or machine or apparatus
- compete (for an advantage or a position)
- defeat someone through trickery or deceit
- ride a racehorse as a professional jockey
- originate (in)
- a statement that deviates from or perverts the truth
- position or manner in which something is situated
- Norwegian diplomat who was the first Secretary General of the United Nations (1896-1968)
- be located or situated somewhere; occupy a certain position
- have a place in relation to something else
- be and remain in a particular state or condition
- tell an untruth; pretend with intent to deceive
- be lying, be prostrate; be in a horizontal position
- assume a reclining position
- walk as if unable to control one's movements
- an unsteady uneven gait
- abrupt up-and-down motion (as caused by a ship or other conveyance)
- a decisive defeat in a game (especially in cribbage)
- move slowly and unsteadily
- defeat by a lurch
- move abruptly
- suggest fear or doubt
- lead someone in the wrong direction or give someone wrong directions
- give false or misleading information to
- quickly and without warning
- marked by rude or peremptory shortness
- the location on a baseball field where the shortstop is stationed
- accidental contact between two points in an electric circuit that have a potential difference
- cheat someone by not returning him enough money
- primarily temporal sense; indicating or being or seeming to be limited in duration
- not holding securities or commodities that one sells in expectation of a fall in prices
- lacking foresight or scope
- (of memory) deficient in retentiveness or range
- low in stature; not tall
- at a disadvantage
- so as to interrupt
- at some point or distance before a goal is reached
- clean across
- without possessing something at the time it is contractually sold
- in a curt, abrupt and discourteous manner
- the fielding position of the player on a baseball team who is stationed between second and third base
- create a short circuit in
- tending to crumble or break into flakes due to a large amount of shortening
- (primarily spatial sense) having little length or lacking in length
- of speech sounds or syllables of relatively short duration
- of insufficient quantity to meet a need
- the act of swindling by some fraudulent scheme
- the use of tricks to deceive someone (usually to extract money from them)
- fool or hoax
- make a fool or dupe of
- hinder or prevent (the efforts, plans, or desires) of
- evade payment to
- cheat somebody out of what is due, especially money
- cause someone to believe an untruth
- be false to; be dishonest with
- be false to; be dishonest with
- a statement that evades the question by cleverness or trickery
- an elaborate or deceitful scheme contrived to deceive or evade
- a quick evasive movement
- make a sudden movement in a new direction so as to avoid
- move to and fro or from place to place usually in an irregular course
- soft creamy candy
- tamper, with the purpose of deception
- (sometimes offensive) an act of swindling or cheating
- (sometimes offensive) to cheat or swindle
- take away to an undisclosed location against their will and usually in order to extract a ransom
- disable by drugging
- an illusory feat; considered magical by naive observers
- deceive somebody
- a prostitute's customer
- a cunning or deceitful action or device
- an attempt to get you to do something foolish or imprudent
- a period of work or duty
- (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- جَہاز يا کَمرے ميں ديوار سے لَگا ہُوا سونے کے لِيے تَختَہ
- کِسی شے کو ضرورت سے زیادہ بڑھاوا دینا
- فریب یا حکمت عملی سے مغلوب کرنا
What is the synonym of dhoka deyba?
Synonym of word dhoka deyba are موڑ دینا, بہکانا, دھوکا دینا یا پٹی پڑھانا, رکاوٹ ڈالنا, دھوکا دینا, چکرا دینا, راستہ بند کر دینا, بتا یا دم جھانسا دینا, جھانسا دینا, نمائش
What are the idioms related to dhoka deyba?
Here are the idioms that are related to the word dhoka deyba.
- Jockey
- Leave in the lurch
- Cheat me in the price but not in the goods
- It is a double pleasure to cheat the cheater
- One trick needs a great many more to make it good