khatka - کھٹکا meanings in English
khatka - کھٹکا meanings in English are cark, tap, switch, qualm, knock, fear, concern, care, anxiety, tappet, rap, knocker, danger, clap, thud khatka - کھٹکا in English. More meanings of khatka - کھٹکا, it's definitions, example sentences, related words, idioms and quotations.
cark tap switch qualm knock fear concern care anxiety tappet rap knocker danger clap thud
khatka - کھٹکا Definitions
Please find 95 English and definitions related to the word khatka - کھٹکا.
- (noun) : activity involved in maintaining something in good working order
- (noun) : a cause for feeling concern
- (noun) : judiciousness in avoiding harm or danger
- (verb) : provide care for
- (verb) : feel concern or interest
- (verb) : be concerned with
- (verb) : prefer or wish to do something
- (noun) : the work of providing treatment for or attending to someone or something
- (noun) : the work of providing treatment for or attending to someone or something
- (verb) : disturb in mind or make uneasy or cause to be worried or alarmed
- (noun) : a sudden very loud noise
- (noun) : a sharp abrupt noise as if two objects hit together; may be repeated
- (noun) : a common venereal disease caused by the bacterium Neisseria gonorrhoeae; symptoms are painful urination and pain around the urethra
- (verb) : strike the air in flight
- (verb) : cause to strike the air in flight
- (verb) : clap one's hands together
- (verb) : strike together so as to produce a sharp percussive noise
- (verb) : strike with the flat of the hand; usually in a friendly way, as in encouragement or greeting
- (verb) : put quickly or forcibly
- (noun) : a dangerous place
- (noun) : the condition of being susceptible to harm or injury
- (noun) : a cause of pain or injury or loss
- (verb) : be afraid or scared of; be frightened of
- (noun) : an emotion experienced in anticipation of some specific pain or danger (usually accompanied by a desire to flee or fight)
- (verb) : be uneasy or apprehensive about
- (verb) : be sorry; used to introduce an unpleasant statement
- (verb) : be afraid or feel anxious or apprehensive about a possible or probable situation or event
- (verb) : regard with feelings of respect and reverence; consider hallowed or exalted or be in awe of
- (noun) : a feeling of profound respect for someone or something
- (noun) : a vigorous blow
- (verb) : knock against with force or violence
- (verb) : find fault with; express criticism of; point out real or perceived flaws
- (noun) : the act of hitting vigorously
- (noun) : negative criticism
- (noun) : a bad experience
- (noun) : the sound of knocking (as on a door or in an engine or bearing)
- (verb) : rap with the knuckles
- (verb) : sound like a car engine that is firing too early
- (verb) : make light, repeated taps on a surface
- (verb) : deliver a sharp blow or push
- (noun) : either of two soft fleshy milk-secreting glandular organs on the chest of a woman
- (noun) : a device (usually metal and ornamental) attached by a hinge to a door
- (noun) : a person who knocks (as seeking to gain admittance)
- (noun) : (Yiddish) a big shot who knows it and acts that way; a boastful immoderate person
- (noun) : one who disparages or belittles the worth of something
- (noun) : a reproach for some lapse or misdeed
- (verb) : strike sharply
- (noun) : the act of hitting vigorously
- (verb) : make light, repeated taps on a surface
- (noun) : the sound made by a gentle blow
- (noun) : genre of African-American music of the 1980s and 1990s in which rhyming lyrics are chanted to a musical accompaniment; several forms of rap have emerged
- (noun) : voluble conversation
- (noun) : a gentle blow
- (verb) : talk volubly
- (verb) : perform rap music
- (verb) : tap a telephone or telegraph wire to get information
- (noun) : a light touch or stroke
- (verb) : make light, repeated taps on a surface
- (noun) : the sound made by a gentle blow
- (noun) : a gentle blow
- (noun) : a plug for a bunghole in a cask
- (noun) : a tool for cutting female (internal) screw threads
- (noun) : a small metal plate that attaches to the toe or heel of a shoe (as in tap dancing)
- (noun) : the act of tapping a telephone or telegraph line to get information
- (verb) : draw from or dip into to get something
- (verb) : furnish with a tap or spout, so as to be able to draw liquid from it
- (verb) : strike lightly
- (verb) : cut a female screw thread with a tap
- (verb) : pierce in order to draw a liquid from
- (verb) : draw (liquor) from a tap
- (verb) : walk with a tapping sound
- (verb) : draw from; make good use of
- (verb) : dance and make rhythmic clicking sounds by means of metal plates nailed to the sole of the dance shoes
- (verb) : make a solicitation or entreaty for something; request urgently or persistently
- (noun) : a lever that is moved in order to tap something else
- (noun) : a vague unpleasant emotion that is experienced in anticipation of some (usually ill-defined) misfortune
- (noun) : (psychiatry) a relatively permanent state of worry and nervousness occurring in a variety of mental disorders, usually accompanied by compulsive behavior or attacks of panic
- (noun) : uneasiness about the fitness of an action
- (noun) : a mild state of nausea
- (verb) : lay aside, abandon, or leave for another
- (noun) : an event in which one thing is substituted for another
- (verb) : exchange or give (something) in exchange for
- (verb) : make a shift in or exchange of
- (noun) : control consisting of a mechanical or electrical or electronic device for making or breaking or changing the connections in a circuit
- (noun) : the act of changing one thing or position for another
- (noun) : a flexible implement used as an instrument of punishment
- (verb) : flog with or as if with a flexible rod
- (verb) : change over, change around, as to a new order or sequence
- (noun) : a basketball maneuver; two defensive players shift assignments so that each guards the player usually guarded by the other
- (noun) : railroad track having two movable rails and necessary connections; used to turn a train from one track to another or to store rolling stock
- (noun) : hairpiece consisting of a tress of false hair; used by women to give shape to a coiffure
- (noun) : a heavy dull sound (as made by impact of heavy objects)
- (verb) : make a noise typical of an engine lacking lubricants
- (verb) : strike with a dull sound
- (verb) : make a dull sound
More words related to the meanings of khatka - کھٹکا
More words from English related to khatka - کھٹکا
View an extensive list of words below that are related to the meanings of the word khatka - کھٹکا meanings in English in English.
abluvionflowanxietycareconcerndesireheedcaressedabutaffectfastenimpingevegetateadhereapplyto be attachedbeginfeel hitknockperceivereachrelishseemshootsproutstickstrikestrucksuittastetouchlagunaluggingabstentionmindfulnesswarinesscautionprecautionprudencecircumspectionincautionmeticulositymeticulousnesscareenedcauterismheedinessheedycautionryaccount ... envisionfancyguessimaginemindsupposethinkconsiderfigureobeyobservepremeditatereckreflectregardnotionatetake careaffiliationaffinityappertainco operationkinkindredcontactrapportattachmentconnectionconnectednessconsiderationlinklinkagenexusrelatednessrelationrelativenessconnexionliaisonaffrightawedismaydreadfrighthorrorterrorapprehensionconsternationdangerfearfearfulnessinsecurityintimidationmisgivingperilphobiascareterrorsjeopardyjittersthreatughapprehensivenessfrightfulnessdreadsfearefearesfearsfeazeagencyagentbrokerinstrumentintermediarymeansmediummiddlemanmotivereasonrelationshipsakeahcompunctionalasdejectiongriefmelancholyregretremorserueruthsadnesssorrowwellawayregretfulwoefulnesspitiedregreetsaddenssorryishagriefwoe begonediocese districtmanorseigniorytenureareabearingcircleholdingjurisdictionlocalityprovinceregionrelevancystateterritoryzonezonuleparvenueterrineterraneterritterreityterritoriedapplicabilityapplicationimputationinclinationputureattaminatelabentappulsebumpbuttingimpactimpingementjustlingcollisioncompetitionencounterrivalrykickstumbleclabberstumblebumstumblerstumperspoutsstrammelstumstummstumpagestoomfame gloryrenownbangdrub malleatemaulribroastblewchastisedashflaplynchmasterovercomeputtbeatjugulatekillknucklesmitestrapzaphittingstrokingbashingbatinghitheskippingsloshessmitsmitingsmittingsmoteto beattaborbashbatterbruiseclobbercontusecurrydefeatdingpoundpunishtickletrouncewallopwhackwhompwhopyerkbeatingblowcouplickhurtimpressioninjurymultiplicationstampstrokewhangmultiphasemultiplicativelymultipliedmultiplesmultipletmultiplieszubrbrontofulminationroarshoutbellowingclapthunderyellthunderheadgregegurgeroarieroarsthundersbuffetfistbopyankmaizeclottedrapslapeimpulseimpulsionjoltshoveslingshotbuntconcussionjerkjogpushpush uppushingpushupburstcrashpurlicuescarkmuseadviceconceptioncounselideaimaginationnotionopinionreflectionsolicitudestewthoughttroublewonderworryalarmriskchargecitationquotationallusionmentionreferenceremithawalareferralcitesreferendarefermentreference tochidingobjurgationadmonitionlessonreprimandupbraidingrebusesreprimandsreprimedreproofedreprovedreprovesrebukedispraisetauntanimadversioncensureinvectivereproachreproachingvituperationreprovalreprovinglyblaiseblamefullyblashyculmingdebarkedrebuffedreproachedreproachesreprobacyreproofsrepugnedreviledrevilinglyclattertapremindknock onspankpacifypattingconflicthurtlejostleclickcollidefoul jouncerun intostrike togetherbump offbump upbumpkinlybumpinghand clapknockingtappingknucksknacksknockingsknopsknuffcogitationconceptualconstancypresensationstupiditysurmisetrendwhimfantasmjudgementphantasmphantomrespectsuspicionthinkingvisionwhimsyideaedperpessionproceptionconfusiondisorderdisturbanceembarrassmentmiscreablenessmiserypuzzlementroutbewildermentdiscomfiture distress harassmentperplexityquandarytortureuncomfortablenessuneasinessvexationvexednesswoeworrimentdasyuredistastefulnessdistraitexacerbationpreoccupancytroublesomenesstroublingworrywartaffretdasyuresdistroubleenshroudshasslingproblemisttrouvaillewoesworrycowacrisyanxietudedroumyfrushprevailmenttroublabletroulupbreathecontentsconstructionpurportspurportstrainedaimimportintentintentionmeaningobjectpurposesensewishmeanlyimplyingmeanermeanesmeaniesmeanwhilescontritionconvoyarrestcapturecustodydetainmentdetentionhandfastimprisonmentlockupcustodecommiserationcompassionventurehazardmenacepitfalldangerousnesshazardousnessperilousnessperiluneperipetyriskinessrisklessnesshazardedhazardinghazardryhazersjeopardermenacesterretshazarderheresiographyjeopardingenterprisemisfortunediffidenceobsessdoubtpalpitationqualmthrushesfaddismillusionkinkmistrustfulnessfantasyobsessionsuperstitionvagaryillusionaldelusionsillusionswhamecapricediscordmordacitypainpinchprickstingdiscouraementdisappointmentdegagedegradeddegraderdegradabledegradesdegreasesdegustsedginesshurryimpatiencewaveringinquietudeperturbationrestlessnessseetheturmoilanergyanxiolyticaphakicdisconcertiondisconcertmentdispiritednessreflexedreflexionrefractilerefractorinessaffricatesaggracesagogicsanxietiesasthoredeflexdeflexeddeflexesdeflexingdeflexionsdismalitydismalsdispiritsinflexuresnervationsperplexesreflexesreflexionsworrywartsdeiformityderogatorinessdisheritingdismastmentdispiritmentdisquietmentinconcerningperplexivenessuphaspfrightenapprehendgallyductspoutconduitjetpipetubewater pumpenquireaskconsultdetergehelpinterrogateinvestigateinvitequaerequestionerrand newsrabbistalkawarenessinformationintelligenceitemknowledgemessagenoticereportrumourwatchfulnesswordtidessayessaysdecaydeclinelanguorpininghallucinationfeud companycontestantcorpspartysectiontroopfictionforeclosureligationmachinationphraseologybondcompositionconstraintlimitationobstructionphraselogyplanrestrictionclosuredebarmentclosingsclosuresdebarmentsdebarringoutagescloshincloisteroffuscationknubbleflare upfuriousnesshuffirritancyirritationmiffprovocationsangerfitfuryincensementindignationinfuriationpassionrageteentemperwaxangrinessangersblousingindignancegrudgemourningchagrindolourinfelicityunhappinessgrieggriecegriecesgriefsmorationsorranceguardianshipmaintenancepreservationdefenceprotectionsafetyjotmitemoleculemonadmoteatomgraingranulemailparticlequantumspeckticktittlekenkenningclose attentionglancelooksightsight gagsightedgazementgazersightlinevisceratessightfulnesskeyteasethreshmultiplyingpastsnakecuredrubbinghidingstrikingmaarknockerhasplatchkindiekindieslensrhythmlakearhythmicrhythmalrhythmedrhythmicsrhythmiserhythmisedrhythmsrhythmusrhythmerrhythmingmasteryoccupancyoccupationtamperaccesscompetenceentrygraspintrusionproficiencyskillintortionnauseapallpukequeasinessmalaisenauseatednauseatingnessmiasmousnauseatesnauseationnauseativeoversightwardwatchkeepinglooking aftersupervisionsurveillancemonitoringmonitorialoversawoverseeingoverseenoversightssupervisalcountenancedoverscentedoverseershipoversellingovershootingoversuresupervacaneoussupervolutesupraciliarysupravisionsurveillantslotionmassagepolishrubbingtripsisunctionpatpanzersattachedconnectedrelatablerelatedannexalannexationalcorrelativityregardantrespectivepertainingrelapsersrelatersrelativalrelativistrelatorrelatorsannexerincorrespondingreglementaryrelationistrelevationpitymercycravespinkboggleloolrustlerapperscrupleknackeringknobblingknoutingknucklingknabbingknobbingsuperviseconcern forlook aftertendwarranttappetabsencedepartingdistanceseparationblastexplosionshotthudguardhedgeinvigilatekeepaftercarecared forgive carecaredcareenagescareeningcareenscherishingcorrectingrearingrenditionimpallidthairmthumpdisgrace jarscoldwarnkhatkhatsjestknock uplaceratebrutifyhazardous undertakingdemurshynessfaucetnose piecenozzlespigotfaucetsvoice of conscience
Idioms with the word khatka - کھٹکا in it
Idioms related to the meaning of khatka - کھٹکا
What are the meanings of khatka - کھٹکا in English?
Meanings of the word khatka - کھٹکا in English are care, cark, clap, concern, danger, fear, knock, knocker, rap, tap, tappet, anxiety, qualm, switch and thud. To understand how would you translate the word khatka - کھٹکا in English, you can take help from words closely related to khatka - کھٹکا or it’s English translations. Some of these words can also be considered khatka - کھٹکا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word khatka - کھٹکا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use khatka - کھٹکا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say khatka - کھٹکا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of khatka - کھٹکا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by کھٹکا?
Meanings of کھٹکا are care, cark, clap, concern, danger, fear, knock, knocker, rap, tap, tappet, anxiety, qualm, switch and thud
Whats the definition of کھٹکا?
Definition of the کھٹکا are
- activity involved in maintaining something in good working order
- a cause for feeling concern
- judiciousness in avoiding harm or danger
- provide care for
- feel concern or interest
- be concerned with
- prefer or wish to do something
- the work of providing treatment for or attending to someone or something
- the work of providing treatment for or attending to someone or something
- disturb in mind or make uneasy or cause to be worried or alarmed
- a sudden very loud noise
- a sharp abrupt noise as if two objects hit together; may be repeated
- a common venereal disease caused by the bacterium Neisseria gonorrhoeae; symptoms are painful urination and pain around the urethra
- strike the air in flight
- cause to strike the air in flight
- clap one's hands together
- strike together so as to produce a sharp percussive noise
- strike with the flat of the hand; usually in a friendly way, as in encouragement or greeting
- put quickly or forcibly
- a dangerous place
- the condition of being susceptible to harm or injury
- a cause of pain or injury or loss
- be afraid or scared of; be frightened of
- an emotion experienced in anticipation of some specific pain or danger (usually accompanied by a desire to flee or fight)
- be uneasy or apprehensive about
- be sorry; used to introduce an unpleasant statement
- be afraid or feel anxious or apprehensive about a possible or probable situation or event
- regard with feelings of respect and reverence; consider hallowed or exalted or be in awe of
- a feeling of profound respect for someone or something
- a vigorous blow
- knock against with force or violence
- find fault with; express criticism of; point out real or perceived flaws
- the act of hitting vigorously
- negative criticism
- a bad experience
- the sound of knocking (as on a door or in an engine or bearing)
- rap with the knuckles
- sound like a car engine that is firing too early
- make light, repeated taps on a surface
- deliver a sharp blow or push
- either of two soft fleshy milk-secreting glandular organs on the chest of a woman
- a device (usually metal and ornamental) attached by a hinge to a door
- a person who knocks (as seeking to gain admittance)
- (Yiddish) a big shot who knows it and acts that way; a boastful immoderate person
- one who disparages or belittles the worth of something
- a reproach for some lapse or misdeed
- strike sharply
- the act of hitting vigorously
- make light, repeated taps on a surface
- the sound made by a gentle blow
- genre of African-American music of the 1980s and 1990s in which rhyming lyrics are chanted to a musical accompaniment; several forms of rap have emerged
- voluble conversation
- a gentle blow
- talk volubly
- perform rap music
- tap a telephone or telegraph wire to get information
- a light touch or stroke
- make light, repeated taps on a surface
- the sound made by a gentle blow
- a gentle blow
- a plug for a bunghole in a cask
- a tool for cutting female (internal) screw threads
- a small metal plate that attaches to the toe or heel of a shoe (as in tap dancing)
- the act of tapping a telephone or telegraph line to get information
- draw from or dip into to get something
- furnish with a tap or spout, so as to be able to draw liquid from it
- strike lightly
- cut a female screw thread with a tap
- pierce in order to draw a liquid from
- draw (liquor) from a tap
- walk with a tapping sound
- draw from; make good use of
- dance and make rhythmic clicking sounds by means of metal plates nailed to the sole of the dance shoes
- make a solicitation or entreaty for something; request urgently or persistently
- a lever that is moved in order to tap something else
- a vague unpleasant emotion that is experienced in anticipation of some (usually ill-defined) misfortune
- (psychiatry) a relatively permanent state of worry and nervousness occurring in a variety of mental disorders, usually accompanied by compulsive behavior or attacks of panic
- uneasiness about the fitness of an action
- a mild state of nausea
- lay aside, abandon, or leave for another
- an event in which one thing is substituted for another
- exchange or give (something) in exchange for
- make a shift in or exchange of
- control consisting of a mechanical or electrical or electronic device for making or breaking or changing the connections in a circuit
- the act of changing one thing or position for another
- a flexible implement used as an instrument of punishment
- flog with or as if with a flexible rod
- change over, change around, as to a new order or sequence
- a basketball maneuver; two defensive players shift assignments so that each guards the player usually guarded by the other
- railroad track having two movable rails and necessary connections; used to turn a train from one track to another or to store rolling stock
- hairpiece consisting of a tress of false hair; used by women to give shape to a coiffure
- a heavy dull sound (as made by impact of heavy objects)
- make a noise typical of an engine lacking lubricants
- strike with a dull sound
- make a dull sound
What is the synonym of کھٹکا?
Synonym of word کھٹکا are چنتا یا سوچ میں ہونا, دیکھ بھال کرنا, فکرا کرنا, خیال کرنا, خیال رکھنا, نگاہ رکھنا, پرواہ کرنا, پوچھنا, دیکھ بھال, احتیاط
What are the idioms with the word کھٹکا?
Here are the idioms with the word کھٹکا in them.
- Cruelty is a tyrant that's always attended with fear
- The faulty stands on the guard
What are the idioms related to کھٹکا?
Here are the idioms that are related to the word کھٹکا.
- Nothing in the affairs of men is worthy of great anxiety
- Clap lay set eye on
- Without danger we cannot get beyond danger
- Not worth a rap
- Rap on the knuckles