Fareb - فریب meanings in English
Fareb - فریب meanings in English are artfulness, fraud, grift, jugglery, lie, mountebankery, net, spoof, trick, trickery, wile, wilfulness, delusive, wileful, decede, decence, fallow, double dealing, chous, cross bite, guile, hoax, hypocrisy, illusion, imposture, juggle, legerdemain, ruse, sham, cheating, deceit, deceiving, deception, desudation Fareb - فریب in English. More meanings of fareb - فریب, it's definitions, example sentences, related words, idioms and quotations.
artfulness fraud grift jugglery lie mountebankery net spoof trick trickery wile wilfulness delusive wileful decede decence fallow double dealing chous cross bite guile hoax hypocrisy illusion imposture juggle legerdemain ruse sham cheating deceit deceiving deception desudation
Fareb - فریب Definitions
Please find 73 English and 2 Urdu definitions related to the word Fareb - فریب.
- (noun) : the quality of being adroit in taking unfair advantage
- (noun) : a deception for profit to yourself
- (adjective satellite) : violating accepted standards or rules
- (adjective satellite) : not faithful to a spouse or lover
- (noun) : cultivated land that is not seeded for one or more growing seasons
- (adjective satellite) : left unplowed and unseeded during a growing season
- (adjective satellite) : undeveloped but potentially useful
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (noun) : shrewdness as demonstrated by being skilled in deception
- (noun) : the quality of being crafty
- (noun) : something intended to deceive; deliberate trickery intended to gain an advantage
- (verb) : subject to a playful hoax or joke
- (noun) : insincerity by virtue of pretending to have qualities or beliefs that you do not really have
- (noun) : an expression of agreement that is not supported by real conviction
- (noun) : an illusory feat; considered magical by naive observers
- (noun) : something many people believe that is false
- (noun) : an erroneous mental representation
- (noun) : the act of deluding; deception by creating illusory ideas
- (noun) : pretending to be another person
- (noun) : throwing and catching several objects simultaneously
- (noun) : the act of rearranging things to give a misleading impression
- (verb) : deal with simultaneously
- (verb) : manipulate by or as if by moving around components
- (verb) : throw, catch, and keep in the air several things simultaneously
- (verb) : hold with difficulty and balance insecurely
- (noun) : the performance of a juggler
- (noun) : artful trickery designed to achieve an end
- (noun) : an illusory feat; considered magical by naive observers
- (verb) : originate (in)
- (noun) : a statement that deviates from or perverts the truth
- (noun) : position or manner in which something is situated
- (noun) : Norwegian diplomat who was the first Secretary General of the United Nations (1896-1968)
- (verb) : be located or situated somewhere; occupy a certain position
- (verb) : have a place in relation to something else
- (verb) : be and remain in a particular state or condition
- (verb) : tell an untruth; pretend with intent to deceive
- (verb) : be lying, be prostrate; be in a horizontal position
- (verb) : assume a reclining position
- (verb) : yield as a net profit
- (verb) : make as a net profit
- (noun) : the excess of revenues over outlays in a given period of time (including depreciation and other non-cash expenses)
- (adjective satellite) : conclusive in a process or progression
- (noun) : a trap made of netting to catch fish or birds or insects
- (noun) : game equipment consisting of a strip of netting dividing the playing area in tennis or badminton
- (noun) : a goal lined with netting (as in soccer or hockey)
- (noun) : a computer network consisting of a worldwide network of computer networks that use the TCP/IP network protocols to facilitate data transmission and exchange
- (verb) : catch with a net
- (verb) : construct or form a web, as if by weaving
- (adjective) : remaining after all deductions
- (noun) : a deceptive maneuver (especially to avoid capture)
- (noun) : a composition that imitates or misrepresents somebody's style, usually in a humorous way
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (noun) : the act of deceiving
- (noun) : a misleading falsehood
- (noun) : the quality of being fraudulent
- (noun) : an illusory feat; considered magical by naive observers
- (noun) : the act of deceiving
- (noun) : a misleading falsehood
- (adjective satellite) : inappropriate to reality or facts
- (adjective satellite) : marked by deliberate deceptiveness especially by pretending one set of feelings and acting under the influence of another
- (noun) : acting in bad faith; deception by pretending to entertain one set of intentions while acting under the influence of another
- (noun) : something intended to deceive; deliberate trickery intended to gain an advantage
- (noun) : intentional deception resulting in injury to another person
- (noun) : an illusory feat; considered magical by naive observers
- (verb) : deceive somebody
- (noun) : a prostitute's customer
- (noun) : a cunning or deceitful action or device
- (noun) : an attempt to get you to do something foolish or imprudent
- (noun) : a period of work or duty
- (noun) : (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (noun) : verbal misrepresentation intended to take advantage of you in some way
- (noun) : the trait of being prone to disobedience and lack of discipline
- ہَل جوتنے کے بَعد چھوڑی گئی ذَمِين
- بعد وضع اخراجات وغیرہ جو باقی رہے
More words related to the meanings of Fareb - فریب
More words from English related to Fareb - فریب
View an extensive list of words below that are related to the meanings of the word Fareb - فریب meanings in English in English.
absolutelybarelynetquitesincereunadulteratedutteractlegerdemainacrobaticsartfeatjuggleryperformanceshenaniganskillsleight of handtacticstrickschauntactivenessagilityartfulnessfleetnessforwardnessfriskinessmanoeuvrepromptitudequirkinessruseslinessalacrityclevernesscraftinessdeftnessfoxinessfraudknacklivelinessmanipulationpertnesstacttactfulnesswilfulnessanimatenesspaltrinesssmarminesstrickinessclerkesscleruchy ... ploidyploverypluviousslickeningsmarteningchalcographyclergialclerklinesscullyismimbecilitateincogitancyincogitativityinvigilancyplatnessaffectationartificialityconstructionconcoctionconformationdispositionedificationequipmentfacefalsification feignfeint fictionfigmentforgingmakemanufacturenatureshamtextureaffectblandishmentconstitutionexaggerationfabricmake upmakingputting on airssimulationstructurestructuraltexturedtextlesstexturestexturingtexturisetexturisedtexturisestexturizedtexturizespharisaismbunkclaptraphypocrisyinsincerityostentationplausibilityshowappearanceairsgasconaderantvaingloryvauntboastbragbraggingmountebankeryvauntingbraggyimposturemachinationcircumventiondeceptionguilequackerypearlinessartificecraftcraftyindustrytradepreposterouscreationdeceitinstinctintriguesagacitywisdominherencyinnatenessnaturismnatalitiesnatiformnaturesconnaturalityconnaturalnessnaturalitynaturelessnaturitycheathoaxhuskillusionlieartificialfalseimitativemockspuriousbastardboguscontriveddudfabricatedfactitiousfakefallowpostichepseudorecordedshoddytraditionalunnaturalunorignalduplicitoussimulatedfacinorousimmingledimpingentmimeticalsimulantsimulantssimulatessimulatingsimulatorycentuplicatedduplicativereduplicativebandagecompressfarmgirthholdingligamenligaturetableteachingtenurebandbeltclampdeligationeye washheadbandinklekerseylathlinelistpartplasterpositionrandribbonrowscreedstrapstripstripetabtapethongtrickzonestipestreepputtistripierstripingsstroutyirdedpateestrippetstryphnicblundererrorfault fiascomiscalculationomissionbevuedelusionfallacyinaccuracymiscarriagemisprisionmistakemistakennessmisunderstandingobliquityerrancyerroneousnessfaultingfaultlessnessimprecisionmisgaugemistakingwrongnesserningerrantryerrantserroristerroristsfalsitiesfaultedmisallegesmistaughtmistuneerrantiaerrationerrorfulevulgateincorrectionmisgiemiskeepmisthrowmistionmistrowmisturnpick faultceremonialgadgetmotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomfashiongaitgimmickryindirectionstratagemtactictrickerywalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackedge flexionforcing pumptagtailwhiffbrawnbreathcourageendenergyextremitygutheftimpetusinertiainstantlifemightmomentpneumatailtempertugvitalityzaptailletrapbluffchouscross bitegimmickjugglemiragemisconceitmisgivingmisguidancemisrepresentationcatchimpositionjapespoofwilecheatingdisloyaltydouble crossgriftdeceptoryduplicitycharcoalfalliblebetrayalwaterdiversion hoodwinkingsophistryburnsmakeshiftexpediencypolicystrategianstrategicsstrategiesstrategeticalstrategeticsstrategicircumlocutiondifferenceturningwindingcomedydramafunmimeryactingdisguise farceimitationimpersonationtravestycontaminationdraff falsehoodfeignedlyhumbuglyingcounterfeitinveracitymendacityuntruthfalsenessuntruthfulnessfalsehoodsliegedomliegeslieslieusuntruthsfalnessliascorruptcorruptedfeloniousnefariousdefectivedishonestfaultyfraudulentinfamousphoneyspitefulcouchlairlatinaefixlightreposerestunbendresittingrestatingrestringrestylingevasion ear ring minoroveraboveloftymadultrauponyoungsterbalasballowcruxentanglementgruelimplexionimplicationkinkwater gruelcoilcomplicationconjeecurlcurvedifficultyfoldindirectnessintorsionnullscrewslewtorsiontwistvolutionwimplepaschpatchedpatchingpatchoulyschlockscrewingbachingleachesmatchetspatchespatchingspatchworkspaunchespechpechsperchingpleuchscreaksscreechesscreichscreighscrewerscrewingsscrewsscrowsscutchscutchesspewstachesboltdiddlehypelurchmisgivemisleadoutwitswindlebafflebamboozlebefoolbeguilebilkbumbazechicanecogdeceivedefrauddeludedodgedupefoolfoxfudgegyphoodwinkjockeynobbleshortshortchangediffidencefaddismmistrustfulnessobsessfancyfantasmfantasyfearideaimaginationobsessionsuperstitionsuspicionvagarywhimwhimsyillusionaldelusionsillusionswhamecapricedisport dissembling guilefulillusiveimpostorknavishriggershiftybamboozlercunningdeceitfuldeceiverdodgerdodgygnosticillusoryimposterinsidiousinsinceremisleadermountebanktrickstertrickywilfulfreebeedissimilar genuinegrotesqueimpertinentrhapsodicdisaffectedsqueamishunalloyedunconnectedcircledilemmamazemisfortunerevolutionturnyawndragsnarevertigoentrapmentgridlatchplexustoiltrepanwebreticulumjollreticulafoolingfoolifystupifyegregiouserroneousimpropermisawrydelusionalflawedinaccurateincorrectmistakenundueunfairwrongwrongfulamissfauxfoul outimpreciselymalposedmiscuemisestimatemismatederrederumpentmisaimmisaimedmisalignedmisalliedmiscalledmiscuedmiscuingmisdatedmisdialmisdidmiseremiseresmisesmisfittedmisformedmisintendmiskeyedmispleasedmisquotedmisratedmisratesmisratingmisseemistedmisteredmistiermistimedmiswentperjuriousperjurouswrongingwrongouseversefalwemiskenmisrendermisrepeatmisseekmiswedmisyuncorrectenchafefashfingergalljokeribtampervexwantonannoydisturbfillipirritatekidmolestnettletauntteasetickletamp downtease aparttee offteeterchafferingtaffetytamesttampingtattersteadteadeteamerteaselingteasellingteasesteeteringteindingtetteringtewarttotherscastigatingirroratemuriculatetabefactionpuzzlementdiscomfortimbrogliolabyrinthmessmorassperplexityrestlessnesstangleconfusednessconfoundednesspretextalibicauseexcusemaskpretencesalvostalepretexfabulousfallacious feigned fictitiousgroundlessknaveliaroscillationslanderousalloyedbraggartduplictiousfaithlesshalf eateninconsistentmendaciousuntrueuntruthfulvainfalselyfalsestlierliadpitchappearbetidedrop encampenterfallhappeninterferemediatesitsleepstaysuffersuitintracranialapocryphalforgedkitschfakeerfakerfakeryfalsiefalsifiablefalsifierfattishforficatephonydummyingfacsimiledfagaceousfaggotedfagotedfakedfakersfakesfakingfalsidicalfalsiesfalsifiedfalsifiersfalsifiesfaucialfordedforfairedforgetiveforjudgedspoofedcounterfeitedcounterfeitlyfalsaryfalsificatorfictiousforwakedfoutyimposturyfaultinessknaverymischiefmischievousnessnaughtinesspranktermagancywaggerywaggishnessbalebamgullimpishnessknavishnessquizrigvicevillainywickednessblackmailfishing netmoneybaitbidconspiracycostdecoyloanpricevalueflounceginmaraudoverrunpillagewallowdepredateextortfleeceflounderforagegibeharrylollplunderreturnrifleriotrobsprawlwringdisplumeloavinglootenrewoundrobbingrevertentrevocateredoundingfrayexcoriatepurefairfine immaculateincorruptinviolatemerenativeneatultimateunblemishedvirginvirginitynettedpuracepureenettiestpuredpureedpureespurerpurespurtiervellicatedglamourjugglinggrudgehostilitytaxaffectionaffinityanimosityantagonismattachmentcorrelationill feelingloveplotrelationrelevancyloggedevicequibblehocusvictimizewheedlemake believevictimisejiltpalaverbrewmalevolencemalicerancourimpiousnessdishonestyfaithlessnessjobberynefariousnessdishonorabledishonorablenessdishonourablenessunmercifulnessdishonoursdishonoraryimmiscibilityunembarrassmentjoustprestidigitationarrestconfinementdetentionhouse arrestinternmentsleightplay tricksdouble dealinginfidelitytreacheryunfaithfulnessdesidiousdesidiousnessknitwattlebecomegathergetpluckpretendselectstitchswankweavebecomingnessknishknitworkknitchesknittleprevaricatelying inliaisinglyinglymisrepresentmisstatemistellwelshmixturesynthesiscompositionconfigurationdecoctioninventionmethodmodeplanrecipesyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismwaitinningopportunitymurderambushnettinggauzegrategrillelatticemeshprotrateuncultivatedseductiontemptationdivagationinstigationsnugnessblastblazeblowflameglowscentwarmthtemporizationcotemporarytergiversatebunkumfablefibfrivolous talkcoquetryflirtingswaggeratonementcandourcatharisisclaritycleanlinesscleansingconservancydefecationdefencedestructioninnocenceluciditynattinessneatnessreconciliationruinsmoothnessvividnesbeguilementdamagelosschacmacoaxinveigleseducediscrepancydabmopmagicmiracledeluderquackfeigningpretentiongraspnoosemasqueradevisorvizardhypocalcaemiahypocorismhypopityshypocausthypocaustsfrictiongashhackoptical illusionloomingelusionabusionrheaevicissitudewagerdauwshow airs
Idioms related to the meaning of Fareb - فریب
What are the meanings of Fareb - فریب in English?
Meanings of the word Fareb - فریب in English are artfulness, cheating, chous, cross bite, fallow, guile, hoax, hypocrisy, illusion, imposture, juggle, jugglery, legerdemain, lie, net, ruse, sham, spoof, wile, deceit, deception, delusive, double dealing, fraud, trick, trickery, wilfulness, deceiving, grift, wileful, decede, decence, desudation and mountebankery. To understand how would you translate the word Fareb - فریب in English, you can take help from words closely related to Fareb - فریب or it’s English translations. Some of these words can also be considered Fareb - فریب synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Fareb - فریب. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Fareb - فریب in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Fareb - فریب in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Fareb - فریب with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by fareb?
Meanings of fareb are artfulness, cheating, chous, cross bite, fallow, guile, hoax, hypocrisy, illusion, imposture, juggle, jugglery, legerdemain, lie, net, ruse, sham, spoof, wile, deceit, deception, delusive, double dealing, fraud, trick, trickery, wilfulness, deceiving, grift, wileful, decede, decence, desudation and mountebankery
Whats the definition of fareb?
Definition of the fareb are
- the quality of being adroit in taking unfair advantage
- a deception for profit to yourself
- violating accepted standards or rules
- not faithful to a spouse or lover
- cultivated land that is not seeded for one or more growing seasons
- left unplowed and unseeded during a growing season
- undeveloped but potentially useful
- the use of tricks to deceive someone (usually to extract money from them)
- shrewdness as demonstrated by being skilled in deception
- the quality of being crafty
- something intended to deceive; deliberate trickery intended to gain an advantage
- subject to a playful hoax or joke
- insincerity by virtue of pretending to have qualities or beliefs that you do not really have
- an expression of agreement that is not supported by real conviction
- an illusory feat; considered magical by naive observers
- something many people believe that is false
- an erroneous mental representation
- the act of deluding; deception by creating illusory ideas
- pretending to be another person
- throwing and catching several objects simultaneously
- the act of rearranging things to give a misleading impression
- deal with simultaneously
- manipulate by or as if by moving around components
- throw, catch, and keep in the air several things simultaneously
- hold with difficulty and balance insecurely
- the performance of a juggler
- artful trickery designed to achieve an end
- an illusory feat; considered magical by naive observers
- originate (in)
- a statement that deviates from or perverts the truth
- position or manner in which something is situated
- Norwegian diplomat who was the first Secretary General of the United Nations (1896-1968)
- be located or situated somewhere; occupy a certain position
- have a place in relation to something else
- be and remain in a particular state or condition
- tell an untruth; pretend with intent to deceive
- be lying, be prostrate; be in a horizontal position
- assume a reclining position
- yield as a net profit
- make as a net profit
- the excess of revenues over outlays in a given period of time (including depreciation and other non-cash expenses)
- conclusive in a process or progression
- a trap made of netting to catch fish or birds or insects
- game equipment consisting of a strip of netting dividing the playing area in tennis or badminton
- a goal lined with netting (as in soccer or hockey)
- a computer network consisting of a worldwide network of computer networks that use the TCP/IP network protocols to facilitate data transmission and exchange
- catch with a net
- construct or form a web, as if by weaving
- remaining after all deductions
- a deceptive maneuver (especially to avoid capture)
- a composition that imitates or misrepresents somebody's style, usually in a humorous way
- the use of tricks to deceive someone (usually to extract money from them)
- the act of deceiving
- a misleading falsehood
- the quality of being fraudulent
- an illusory feat; considered magical by naive observers
- the act of deceiving
- a misleading falsehood
- inappropriate to reality or facts
- marked by deliberate deceptiveness especially by pretending one set of feelings and acting under the influence of another
- acting in bad faith; deception by pretending to entertain one set of intentions while acting under the influence of another
- something intended to deceive; deliberate trickery intended to gain an advantage
- intentional deception resulting in injury to another person
- an illusory feat; considered magical by naive observers
- deceive somebody
- a prostitute's customer
- a cunning or deceitful action or device
- an attempt to get you to do something foolish or imprudent
- a period of work or duty
- (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- the use of tricks to deceive someone (usually to extract money from them)
- verbal misrepresentation intended to take advantage of you in some way
- the trait of being prone to disobedience and lack of discipline
- ہَل جوتنے کے بَعد چھوڑی گئی ذَمِين
- بعد وضع اخراجات وغیرہ جو باقی رہے
What is the synonym of fareb?
Synonym of word fareb are چالاکی, عیاری, فیلسوفی, حرفت, فطرت, فریب, چھل, روباہ بازی, پھلاسڑے باز, صفائ
What are the idioms related to fareb?
Here are the idioms that are related to the word fareb.
- It is a fraud to conceal a fraud
- Deceiving a deceiver is no knavery
- Hypocrisy pays
- To juggle with
- Fraud is safe in no hiding place