Utarna - اترنا meanings in English
Utarna - اترنا meanings in English are dwindle, disembarks, disembowelment, disembarrass, disembarkment, disembarkation, light, lessen, get off, get down, befall, waste, tabernacle, pitch, house, encamp, disembogue Utarna - اترنا in English. More meanings of utarna - اترنا, it's definitions, example sentences, related words, idioms and quotations.
dwindle disembarks disembowelment disembarrass disembarkment disembarkation light lessen get off get down befall waste tabernacle pitch house encamp disembogue
Utarna - اترنا Definitions
Please find 70 English and definitions related to the word Utarna - اترنا.
- (verb) : become smaller or lose substance
- (verb) : live in or as if in a tent
- (noun) : the members of a business organization that owns or operates one or more establishments
- (verb) : make smaller
- (verb) : decrease in size, extent, or range
- (verb) : wear off or die down
- (adjective satellite) : marked by temperance in indulgence
- (verb) : alight from (a horse)
- (noun) : merriment expressed by a brightness or gleam or animation of countenance
- (adjective satellite) : (used of vowels or syllables) pronounced with little or no stress
- (verb) : start or maintain a fire in
- (verb) : heel over
- (verb) : set the level or character of
- (verb) : sell or offer for sale from place to place
- (noun) : abrupt up-and-down motion (as caused by a ship or other conveyance)
- (verb) : move abruptly
- (noun) : the action or manner of throwing something
- (noun) : an all-fours game in which the first card led is a trump
- (noun) : a high approach shot in golf
- (noun) : the property of sound that varies with variation in the frequency of vibration
- (noun) : degree of deviation from a horizontal plane
- (noun) : a vendor's position (especially on the sidewalk)
- (noun) : any of various dark heavy viscid substances obtained as a residue
- (noun) : promotion by means of an argument and demonstration
- (verb) : set to a certain pitch
- (verb) : lead (a card) and establish the trump suit
- (verb) : hit (a golf ball) in a high arc with a backspin
- (verb) : erect and fasten
- (verb) : fall or plunge forward
- (verb) : throw or hurl from the mound to the batter, as in baseball
- (verb) : be at an angle
- (noun) : (baseball) the act of throwing a baseball by a pitcher to a batter
- (noun) : a sports field with predetermined dimensions for playing soccer
- (noun) : an uninhabited wilderness that is worthless for cultivation
- (verb) : get rid of
- (verb) : spend extravagantly
- (noun) : useless or profitless activity; using or expending or consuming thoughtlessly or carelessly
- (verb) : cause to grow thin or weak
- (noun) : (law) reduction in the value of an estate caused by act or neglect
- (noun) : any materials unused and rejected as worthless or unwanted
- (noun) : the trait of wasting resources
- (verb) : run off as waste
- (verb) : use inefficiently or inappropriately
- (verb) : lose vigor, health, or flesh, as through grief
- (adjective satellite) : located in a dismal or remote area; desolate
- (verb) : cause extensive destruction or ruin utterly
- (verb) : become physically weaker
- (verb) : happen, occur, or be the case in the course of events or by chance
- (verb) : become of; happen to
- (noun) : the act of passengers and crew getting off of a ship or aircraft
- (noun) : the act of passengers and crew getting off of a ship or aircraft
- (noun) : the act of removing the bowels or viscera; the act of cutting so as to cause the viscera to protrude
- (verb) : take the first step or steps in carrying out an action
- (verb) : lower someone's spirits; make downhearted
- (verb) : pass through the esophagus as part of eating or drinking
- (verb) : move something or somebody to a lower position
- (verb) : alight from (a horse)
- (verb) : lower (one's body) as by kneeling
- (verb) : put down in writing; of texts, musical compositions, etc.
- (verb) : escape potentially unpleasant consequences; get away with a forbidden action
- (verb) : send via the postal service
- (verb) : transfer
- (verb) : get high, stoned, or drugged
- (verb) : alight from (a horse)
- (verb) : deliver verbally
- (verb) : get out of quickly
- (verb) : enjoy in a sexual way
- (verb) : be relieved of one's duties temporarily
- (verb) : cause to be acquitted; get off the hook; in a legal case
- (verb) : leave a vehicle, aircraft, etc.
More words related to the meanings of Utarna - اترنا
More words from English related to Utarna - اترنا
View an extensive list of words below that are related to the meanings of the word Utarna - اترنا meanings in English in English.
abasedisembarkhouseimpairingestlessenshedtake downtake offunfixunloaddisembroildraw offstripped downunlashunlashingablativeapparentbrilliantevidentilluminateillustriousirradiantlightlucentlucidlustrousopensshinysparklysunnyablazebrightclearexplicitilluminatedlitluminescentluminousshiningsplendidenkindledlightedbrightenedbrighterbrightsomeillimitedillumedilluminedillumines ... illuminguplightedwightedilluminousabridgeminifyscantleshortenabodedwellingfarmstead homehomesteadlenitivemansionmollifierdomicilehabitationpalliativemawkinmuchkinmucinogenreclinantabatescontempercurtaildiminishepitomizemitigatemoderaterazeeabateassuagedecreaseextenuateimpeachrebatereduceretrenchalleviatedimwitlesseninglessingloweringreducingabatingallayingdilutingdimidiatelowsingminishmitigatesundeifyundernoteundervoicedemephitizingreducentreductreductivelycondensedischargelighten upslightingmildeningslightendispraisenarrowquenchbatedeductdemeandepletedetractknock offmollifysubtractaccommodationdwelling placeedificepilesitespacehousingproper placewhereaboutshousesitmounaccursedpatientwastedestroyeddevastateddilapidatedruinedspoiledwasteddiscomfiteddoomedruntspurnedwreckedheiredruinatedruinatesruinatingruingruntishrutilatedwassailedwasteredwasteringwreakedvernaclewrekeaggravatebalkbungledisabledistort foilmarmildewmismanagemoiloverleavencorruptdebauchdefacedegradedetortflubinfectinjuremisspendruinspoiltarnishvilifyvitiatewrithemorigerateperverterdisturnarsonfulminateignitefireflameinflameignifyincensationarticulatacandidcleanlydiaphanous empyrealfoolproofglaringglossyguilelessimpartiallimpidneatovertlysinceresmugtaint freetaintlesstidywhistlecleanclearlydirect distinct distinctly downrightevenexpresslyfairingenuouslegibleopenlyplainplainlypurestraightforwarduncontaminatedbrushedcleanableclearedneatenunbrushedbrushlesscleanedcleanscleansedcleansescleatedneapedneatenedneaterpurfledpurgedpurledrefiguredrepinedsanifiedsweepytiddyunswatheswipedperfectawningtabernaclecanopymarqueetentbitumendrivelgalipotspitspwaltarpitchresinsalivaspittleresinsbreeddynastygnarlhouseholdlineagebuilderectestablishfixfoundconstituteinstallinstateinstitutepositsetconstatingestablishingestuatinginstitutingbungalowcapsulefire sideholemortisenestbirthplacecasefamilyhabitatholderresidenceshebangsourcehouherehomedhouselbuoyantfutileimponderousneapslowthincheapineffectualinferioringloriouslittlemildshallowyeastypimpledsildlightenedmildenvildwadedimponderableslimagiledelicatefrivolousinsultablelissomenimbletriflingin vainvilevolantburngrudegekindlemeetspunkburnsideembrittledurnjiltingdiscernibleopenovertbroaddisclosedexotericexpandedknownloosemanifestnakeduncoveredunlockedunrestrictedvisiblewide openopeneduncloakedunkedcolumnsgroovecompartmentdivisionpanelpartitionpigeonholereceptacleroomsectioncauterizecremateenlivenquickencombustconflagratefosterset firevexburn offburn outburn upenkindlekindlinggurningateirisateirradicatekittlingurningincantingcastdiscard dumpejaculationejectdashflinghurlhurtlejerklaunchlobmewrejectscatterslamspillsquanderthrowthrowawaytiptosswaivewarpdrowse offhurlinginfoldingpeltslingslingingthrash outpulpingsnaringsnarlingstrowingthrawthreapthreapingtrowingDisposed Offmicaceousbrinyflaskfulglabrousglazedshinnydazzlingsglintedglisteredglitteredglitzygloweredglozedgluishglutenoussheensshiniershoneensspeckygalsomeglomeroussparkfulclear sightednesseyesightvisionvisualityclichecrusheddowntroddenquotidianthreadbaretroddenunder footglumpclotcoagulatecongealcoherefastenmotherquadratevegetateconsolidatefreezegrowhardeninduratejelltake rootclottyclotburclottingclompingclotterclotteredclotteringcloturingcoagulatingcouchliereposerestunbendresittingrestatingrestringrestylingconsumefiddlemisemploylosewasting awaydiscomfitsdiscommondiscounseldeliquatedemideifydiscompanydiscomptdispenderexsufflicateforfeteobliteratingcoupletversecouplebaitscolorlessflaggyluridpallidblandbleakcolourlessdrabdullfaintgreyinsipidjejunelanguidmawkishpaleremisstastelessvapidwashywershwishy washyfadecrop outcrackleglitteroutshinelightenradiatecrumpledwindlepuckersblenchshrinkshroffingcraprubbishwaste paperrejecteduselesswastepaperworthlesscriticalfragiletendersbrittlefine frailgracileprecarioussensitivesilkyslendertenuousticklishnazificationdelineablefragfraggeddesitivelignousdamagedilapidation disservice encumbrances hurtfulnesshurtlessmischiefmissdeficitdestructiondetrimentharmhavochurtinjurylossreversescathewastageincurvationdamnationsdamnifiesdetrudesdowncomeharmineoncomedamnificationdigestdissolvemeltdissolublenessdissolvabilityeradicationannihilationdecaydevastationdownfallfiascoharrowingjadednessruinationundoingwreckwreckerjavelinsruiningswastageswastenesswasterywasteswastingswreckersruiniformvastationvernagewastorforlorn abandonedgauntlonelonelyuninhabiteddipdrown implungewhelmbogdestroydiveimmersesinksubmergedisbursespenduseexpendingincurvecompendfuseliquefyrotboildecomposeentendersoftentenderisedrawers hosekneewanewantletuplullquailsubsideknock kneedkneltknack kneeddrill dry emaciateoozepinewater fallcascadewaterfallcrinkle rootpetershrivelrecedingsparsenessdimblelessensdecreaselesslowlihoodreduciblenessreductibilityablaqueationrampageto become angrybungleddegeneratehuffcorrivateelapsiondwellholdkeepnestlewonabideinhabitliveremainresidestaylive inaccomptindweltlivingsinhabitateeasyeffortlessfacileconvenientfeasibleglibmanageableold shoepainlesssimplifiedsimpsimperedsimperingsimperssimpledsimplersimplingconvellenteffigialeffodientchafercorvesgavelmengrisettemansionarymansionsquaverersmansionryquavemiresequestraleffulgenceglanceglaregleamglintglossglossinesslucencysunshinebrilliancyflashflashinglightningluminescencepolishscintillasheenshinetwinklevarnishbrashnessbrillbrininessbristlinessfadflashinessgimpinessgleaminggloamglomgloweringgluinessglumnessluridnesslustermagnanimousnessshinglesshininessspandrelsparklesparkleberryvoluminousnessaurasblitzesbrassinessbriningbrinksbriskensflashesflasksfleshesgashlinessgigglesgleamedgleamiergleamingsgleamsglimmeredglimsglintsglisksglistensglitzinessgloamingsgloireglomeratedglomsgloriesglowlampglowslustersshashesspanglesspangssparkledsparklessparkletspecklingsplorethimblingwhimsbrilliantnessbrinishnessbrushinessglabrityglaseglebositygliresglomeglomerationgrintshiningnesslustredivine lightrefulgencenurnurrknoremblazeenlightenillumeillustrateilluminelight uplighting upilluminingbrighteningillightenilluminizeilluminizinginlightenencampsitostendstaylacelingereventuatecome aboutoccurappearbetidedrop enterfallhappeninterferemediatesleepsuffersuitintracranialfierceblazeflareflameletflemewaitdelayintermitlodgestoplastputtickengroundratifyallocateflaccid hollowemptyflabbyinanesoftspongypuladesolatewilddesolatelydespoilationdespoileddespoilmentdelateddesertlessdesolateddesolaterdesolatersdesolatesdesolatingdesolatordesolatorsdesertfulforayrazecrusheradicateexterminateharrystompmaraudplunderfraygiveminorminutenegligibleslightlyinsignificantnugatorypettyslighttrivialunimportantglimlightingphotoradiancetaperilluminationlamplight uponpenlightaluminatesupplightmonasterypavilionderaywatchfulalcoholcountrycuredruggallowsgibbetremedykeddahinciteluntrouseillapsebefallelapseexpirebrightnessfame gloryhonourilluminantpropulsionboozinessfosteredjuicytersedeliciousgenteelgustfullenientsavourysubtlelatescentlattenslichtlysubtiledawnday breakrayyokejumentmoonbeammoonlightmoonshinemoonseedmoonbeamsmooniestmoonletmoonrakingmoonrockmoonsailsmoonsheesmoonshinymooneryoverrundeletedemolishdilapidateperishsmashruinatemiscreablenessmiserymisfortunepredationtwilightdisastermiserablnesspogrompredatingwrackdestructibilitydisownmentperditioncataclasmscataclysmscatastasescatastasisdepasturesdestructsdismastshavocsravagesrivagecatasterismcatastrophismdastardnessdestriedestructiblenessdestruiedevastdistastureimpastationimpastureperishmentdebacleoutrootovershadowharbourhovelsheltercamptilttentaculatentaculumtentagetentationsplendourprodigalityprofusenessprofusionwastefulnessexpensivenessextravagancesplurgeextravagancyextraversiveextravertiveextravaganciesextravagantnessextravagationextravasatedprosperousbattenget offprosperthriveexterminationhoverloitervestdescendalightarrivebarbeamglimpsereflectionshadebird's nesthaltcomedylight bonedlight heartedlightheadedlightheartedlightweightlukewarmlypelagictouchy feelyfiddliergentlergentrifiedlightfulmildenedpalaveringpalewisepulpiteerskitteringuphurledpulverizableredditiverighteousedclairvoyancedegreefitkettledrumopportunityplightstatetimeturnwatchdissipationostentationpompescaperun awayhorsehareemhareemssunlightunderweightmisplace
Idioms related to the meaning of Utarna - اترنا
What are the meanings of Utarna - اترنا in English?
Meanings of the word Utarna - اترنا in English are dwindle, encamp, house, lessen, light, pitch, tabernacle, waste, befall, disembarkation, disembarkment, disembarrass, disembowelment, get down, get off, disembarks and disembogue. To understand how would you translate the word Utarna - اترنا in English, you can take help from words closely related to Utarna - اترنا or it’s English translations. Some of these words can also be considered Utarna - اترنا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Utarna - اترنا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Utarna - اترنا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Utarna - اترنا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Utarna - اترنا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by utarna?
Meanings of utarna are dwindle, encamp, house, lessen, light, pitch, tabernacle, waste, befall, disembarkation, disembarkment, disembarrass, disembowelment, get down, get off, disembarks and disembogue
Whats the definition of utarna?
Definition of the utarna are
- become smaller or lose substance
- live in or as if in a tent
- the members of a business organization that owns or operates one or more establishments
- make smaller
- decrease in size, extent, or range
- wear off or die down
- marked by temperance in indulgence
- alight from (a horse)
- merriment expressed by a brightness or gleam or animation of countenance
- (used of vowels or syllables) pronounced with little or no stress
- start or maintain a fire in
- heel over
- set the level or character of
- sell or offer for sale from place to place
- abrupt up-and-down motion (as caused by a ship or other conveyance)
- move abruptly
- the action or manner of throwing something
- an all-fours game in which the first card led is a trump
- a high approach shot in golf
- the property of sound that varies with variation in the frequency of vibration
- degree of deviation from a horizontal plane
- a vendor's position (especially on the sidewalk)
- any of various dark heavy viscid substances obtained as a residue
- promotion by means of an argument and demonstration
- set to a certain pitch
- lead (a card) and establish the trump suit
- hit (a golf ball) in a high arc with a backspin
- erect and fasten
- fall or plunge forward
- throw or hurl from the mound to the batter, as in baseball
- be at an angle
- (baseball) the act of throwing a baseball by a pitcher to a batter
- a sports field with predetermined dimensions for playing soccer
- an uninhabited wilderness that is worthless for cultivation
- get rid of
- spend extravagantly
- useless or profitless activity; using or expending or consuming thoughtlessly or carelessly
- cause to grow thin or weak
- (law) reduction in the value of an estate caused by act or neglect
- any materials unused and rejected as worthless or unwanted
- the trait of wasting resources
- run off as waste
- use inefficiently or inappropriately
- lose vigor, health, or flesh, as through grief
- located in a dismal or remote area; desolate
- cause extensive destruction or ruin utterly
- become physically weaker
- happen, occur, or be the case in the course of events or by chance
- become of; happen to
- the act of passengers and crew getting off of a ship or aircraft
- the act of passengers and crew getting off of a ship or aircraft
- the act of removing the bowels or viscera; the act of cutting so as to cause the viscera to protrude
- take the first step or steps in carrying out an action
- lower someone's spirits; make downhearted
- pass through the esophagus as part of eating or drinking
- move something or somebody to a lower position
- alight from (a horse)
- lower (one's body) as by kneeling
- put down in writing; of texts, musical compositions, etc.
- escape potentially unpleasant consequences; get away with a forbidden action
- send via the postal service
- transfer
- get high, stoned, or drugged
- alight from (a horse)
- deliver verbally
- get out of quickly
- enjoy in a sexual way
- be relieved of one's duties temporarily
- cause to be acquitted; get off the hook; in a legal case
- leave a vehicle, aircraft, etc.
What is the synonym of utarna?
Synonym of word utarna are سکڑنا, گھٹنا, کم ہو جانا, بتدریج گھٹنا, سمٹنا, کم ہونا, چھیجنا, چھوٹا ہونا, اترنا, بگڑنا
What are the idioms related to utarna?
Here are the idioms that are related to the word utarna.
- Good things befall the good
- House to house
- The house is a fine house when good folks are within
- Pitch
- Pitch and pay