haasil - حاصل meanings in English
haasil - حاصل meanings in English are yieldance, attornment, attaints, attainted, attains, acquites, acquires, acquiesces, achieved, avulsed, gained, gainsaying, attaintment, yielded, obtains, grossed, gettings, gettered, garnered, gainst, geta, attorn, duty, custom, crop, consequence, produce, outcome, illation, getting, gain, harvest, inference, attained, sum, revenue, return, result, realised, product, proceeds, effect haasil - حاصل in English. More meanings of haasil - حاصل, it's definitions, example sentences, related words, idioms and quotations.
yieldance attornment attaints attainted attains acquites acquires acquiesces achieved avulsed gained gainsaying attaintment yielded obtains grossed gettings gettered garnered gainst geta attorn duty custom crop consequence produce outcome illation getting gain harvest inference attained sum revenue return result realised product proceeds effect
haasil - حاصل Definitions
Please find 103 English and definitions related to the word haasil - حاصل.
- (verb) : feed as in a meadow or pasture
- (noun) : a pouch in many birds and some lower animals that resembles a stomach for storage and preliminary maceration of food
- (verb) : let feed in a field or pasture or meadow
- (verb) : prepare for crops
- (noun) : the stock or handle of a whip
- (noun) : the output of something in a season
- (noun) : a collection of people or things appearing together
- (noun) : a cultivated plant that is grown commercially on a large scale
- (noun) : the yield from plants in a single growing season
- (verb) : cut short
- (verb) : yield crops
- (noun) : accepted or habitual practice
- (noun) : habitual patronage
- (noun) : a specific practice of long standing
- (noun) : money collected under a tariff
- (adjective) : made according to the specifications of an individual
- (noun) : the central meaning or theme of a speech or literary work
- (noun) : an impression (especially one that is artificial or contrived)
- (noun) : a symptom caused by an illness or a drug
- (noun) : an outward appearance
- (verb) : act so as to bring into existence
- (verb) : produce
- (verb) : win something through one's efforts
- (verb) : earn on some commercial or business transaction; earn as salary or wages
- (noun) : the amount by which the revenue of a business exceeds its cost of operating
- (noun) : the amount of increase in signal power or voltage or current expressed as the ratio of output to input
- (noun) : the advantageous quality of being beneficial
- (noun) : a quantity that is added
- (verb) : increase (one's body weight)
- (verb) : obtain advantages, such as points, etc.
- (verb) : derive a benefit from
- (verb) : obtain
- (verb) : rise in rate or price
- (verb) : reach a destination, either real or abstract
- (verb) : increase or develop
- (noun) : the act of acquiring something
- (noun) : the reasoning involved in drawing a conclusion or making a logical judgment on the basis of circumstantial evidence and prior conclusions rather than on the basis of direct observation
- (noun) : something that results
- (verb) : cause to happen, occur or exist
- (noun) : the whole amount
- (noun) : a set containing all and only the members of two or more given sets
- (noun) : the final aggregate
- (noun) : a quantity of money
- (verb) : be a summary of
- (verb) : determine the sum of
- (noun) : a quantity obtained by the addition of a group of numbers
- (adjective satellite) : achieved or reached
- (verb) : acknowledge a new land owner as one's landlord
- (noun) : a government tax on imports or exports
- (noun) : work that you are obliged to perform for moral or legal reasons
- (noun) : the social force that binds you to the courses of action demanded by that force
- (noun) : footwear usually with wooden soles
- (noun) : the yield from plants in a single growing season
- (noun) : the season for gathering crops
- (noun) : the gathering of a ripened crop
- (noun) : the consequence of an effort or activity
- (verb) : remove from a culture or a living or dead body, as for the purposes of transplantation
- (noun) : the reasoning involved in drawing a conclusion or making a logical judgment on the basis of circumstantial evidence and prior conclusions rather than on the basis of direct observation
- (noun) : the income or profit arising from such transactions as the sale of land or other property
- (noun) : the set of elements common to two or more sets
- (noun) : commodities offered for sale
- (noun) : an artifact that has been created by someone or some process
- (noun) : a quantity obtained by multiplication
- (noun) : a consequence of someone's efforts or of a particular set of circumstances
- (noun) : a chemical substance formed as a result of a chemical reaction
- (adjective satellite) : successfully completed or brought to an end
- (verb) : issue or terminate (in a specified way, state, etc.); end
- (noun) : something that results
- (noun) : a statement that solves a problem or explains how to solve the problem
- (noun) : the semantic role of the noun phrase whose referent exists only by virtue of the activity denoted by the verb in the clause
- (verb) : come about or follow as a consequence
- (verb) : produce as a result or residue
- (noun) : a quick reply to a question or remark (especially a witty or critical one)
- (verb) : be inherited by
- (verb) : give or supply
- (verb) : bring back to the point of departure
- (verb) : be restored
- (verb) : answer back
- (verb) : go back to something earlier
- (noun) : the occurrence of a change in direction back in the opposite direction
- (verb) : pass down
- (noun) : a reciprocal group action
- (verb) : pay back
- (noun) : a coming to or returning home
- (noun) : document giving the tax collector information about the taxpayer's tax liability
- (noun) : the income or profit arising from such transactions as the sale of land or other property
- (noun) : the act of someone appearing again
- (noun) : getting something back again
- (noun) : the act of going back to a prior location
- (noun) : (American football) the act of running back the ball after a kickoff or punt or interception or fumble
- (noun) : a tennis stroke that sends the ball back to the other player
- (noun) : the key on electric typewriters or computer keyboards that causes a carriage return and a line feed
- (noun) : happening again (especially at regular intervals)
- (verb) : go back to a previous state
- (verb) : make a return
- (verb) : give back
- (verb) : return in kind
- (verb) : elect again
- (verb) : submit (a report, etc.) to someone in authority
- (verb) : go or come back to place, condition, or activity where one has been before
- (verb) : return to a previous position; in mathematics
- (noun) : the entire amount of income before any deductions are made
- (noun) : government income due to taxation
More words related to the meanings of haasil - حاصل
More words from English related to haasil - حاصل
View an extensive list of words below that are related to the meanings of the word haasil - حاصل meanings in English in English.
abolishbreakcrackcreasecropculldisembodydisjoin disprovedisseverdissolvabledissolvedividedistort disbandfoilmasteroverpowerrazerupturewrestinfractinfringelaceratepluckrendresolveviolatebreak loosebreaking awaybreaking offsmashingparrockingunbracingaccessgangwaygateroutetrackventwaycoursecustomheadwayjourneymethodpathprogressroadroadmap ... wentaccordblenchchafedco operatecomportconcurcongregatecorrespondentcoupleconnectfindfretgaingetgreetkneadknitleaguemashminglemixoccurquadratetallyclubcombineconsistintroducejoinmeetobtainconfreremeetnessacquirecreditsprocureachieveknowovertakereceiverecognisesecureundergowrenchdrawearncollectpick uppossesswrangleattaintacquistattaintingavulsinggaininggetteringacquitteractactscarjoblewdmanufacturedutyemploymentmissionprofessionundertakinguseutilityworkactionconscienceenemafunctionmotionoperationalperceptionadministrationdeedeffectexecutionexorcismexploitfeatgestmeasurenounoperationpracticeprocedureprocessworkingactuationsadherencesenactionsimplementsimpletionimpletionsprocessesprosesadactproceresaffiliateconstituteconstructcreateerectfablefabricatefeignfoundframemakemanufacturesmouldbuildcoinconfigureedifyforgeinitiatelaughproducevampfabricatingmeakingariseengender fathergenerategrowpropagateswakenbreedelicitgenderinventmanifestprocreateteemyieldarousinggeneratingingenerateproducingaggregateaggregate numberdynastyeaseengine entirefullygeneralginlivelongpiecelessteetotala good manyallcompleteeachgrossmorrowsumtomorrowtotaluniversesubtotaltotaledmorrowstomorrowstotalisedtotalizestotalledtotallingtotalstotienttottedyesterdaysconcurrenceconfluencecontiguitycouplingcounterpartjoinderjoiningjointjunctionlimbmachinationmatchpairpatchseamaccountadditionconnectionconnectednesscontenderinosculationjuncturekinshipknuckleknuckle jointlinklinkagemarrowsolderingsutureaddlesfoldedjoiningsjointsfolded uplibrabalanceapproacharrivalimportimportationmuseadventcomingvisitarriagearriagesarrivalsarrivancearrivismearrivistesinflowsinfluxesinfluxioninfluxionstoomingavailablecarpillationvegetablefruitharvestknife bladeprofitprogenyresultrewardfructificationfruitionbruitsfrigsfrithfroisefroisesfromentyfrowstsfructifiedfruitedfruiteressfruitiestfruitingsfruitionsfruitivefruitsfrumentiesfrutexfruticesripesspruitfruit'yavertcontradictdabdistractveerpolishrejectreturnreversespinstroketrollturntwisttavertavailabilityprocurementachievementacquisitionadvantageattainmentproductrealisationacquirementachieveracquisitivenessobtainmentacervationachievingattainturepursuitsaccorporateacervalachievanceacquiescingacquietacquiryperquisitionprocurationbackslidewarpback outturn againstblowbringfetchadducebring overbring underbuyincludeinductplantpurchasewin overbring tolanailanaburdensomenessdraft entranceencumbranceoverpressureburdenchancegriefimpositionliabilityloadobstacleoccasiononusopportunitypermissionraintimeweightcausecausalbring aboutgroundmotivereasonrelationshipcarvedissect dribepitomizegarblegridehoemownibblenippassripscissorwhittlebite snakechapchiselchopcleaveclipcurtailcutdeductdiscountdisuniteexcludehackimpugninciseinterruptknifemutilatenullifyoccludeopenreaprefutesevershearstrike outbaitingbite offbite outchop chopchopinecut tocutting outslicingbittingchoppingkiltingreapssaddlelesschopnesssootetruncateceremonialtraditionceremonyformalityhabitudeinstitutelawmodelordinationritualrulewontrit.ritualiseritzyrittersrittingrittsritualizesritziestcraftgadgetmanoeuvremovemovementpassagespeedstepstrategysubterfugeactivityanticconductdeceitdeceptionfashiongaitgimmickryguileindirectionruseshenaniganstratagemtactictricktrickerywalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackconstitutionguisemannerusagechorenecessityobligatoryobligationsdivine ordinanceon handincumbentincumbencyindispensablemoral obligationresponsibilitystatutesuppositionassuetudesassumpsitassuefactionsupposurechapterdistinctiondivisionfieldclausepartitionsectionseparationweatherchiefchairchargedesignationofficepositionpostrankdesignmentassithmentclapper clawavulseclawfleecehentraunchscratchsnatchtweaktwitchembrittledcommodityfreight fundgearmammonpropertywareassetsbelongingcargodaintiesgoodslootlucreluggagemerchandisemoneyrevenuerichesstockcompensationcounter buffoverturnflightrequitalretaliationretreatrevengerevertrevolutionslewthrow backvolte faceconsequencesconsequencewagesapodosisnemesisquittancerecompenserepaymentvengeanceconducivemindedobliqueaffectedaimaptbentbiasedenamouredendinterestedpartialvergingdiscomposeddisinclinedimpugnedinclinableinclinesinduedinterlinedmoilstendedinclinatorymouilleconsummationconclusionfine finisquietusterminusdenoumentfinalityissueoutcomepayoffsequelterminationupshotenduesrenditionsenduementconvertaltercome backinvertreboundrecederecoilretirereverberaterevolvetoppleturn backturnoverwendpulletflimpsflinchingunplumbingunplumingflippantnessoutgrowthaftermathcorollaryinferencerepercussionenduefalchionoutguessresultantconcauseconcausesforthcomeocclusionsocclusivesoutfallsresultantsresultedresultingsequelsunflushesupcomeconsequentialnessresultancehonourimportanceoutweighsvalueamountappreciationcreditdegreedignityfavourgreatnessmagnitudemeritmodulusquantityvalenceworthvalorizesvalureconfidencecreditabilityhopeimplicitnessfaithin respect toreliancetrustcredentreliquiaeconventionmoresobservancecustodiescustomablecustoscustrelscustomarinesscommitmenton one's handincurrenceresponsiblenessdukeshipresponsoryresponsumchargeablenessliablenessresponsioncompanycaptorgovernanceimpactimpressioninfluencemarkruinsigntouchtraceeffervescencyaffectednesseffectivityeffectoreffectuationeffendieffervesceeffervescingimpactiontake effecteffaceseffeireffierceeffingefforceeffrayeffseffulgeseffusesrefluenceseffectioneffectuatingeffectuoseeffeteffluencygnawknabmumprazeepruneselectchoosehewinfiltratepickpreengravesculptrimlytrimnesstrimmesttrimminglytrisectiontruncatingscolaypenningpenancingpenelopizecrawgizzardmawcapacitystatusstomachmagnanimitycouragedesiremoraleresolutionspiritgireculturefarmholdingcultivated landcultivationtenuretilthcriterionmaximbaseetiquette formulahabitmannersestablished orderprincipleregulationemblementyieldersyieldingsyieldscustomstaximpostlevyscattarifftaxationtollrevenuesculminationdisgorge discard gainsaykeckwardabrogatebaulkbrush offdisapproverebutrefelrefuserepudiatespurndenudaterefractdenudingdispungerebuttingreflatingreistingrejudgerejudgingabjudicateabjudicationdepudicatedisacknowledgedisacknowledgingrejoltreparteeingrepudiatingdividendmanurecumanaearningsincomeancomeancomesearingsincomesupcomesearth gratuitymeedwagesawmsawaheconomicsnaturalnumskulleductionfinal sempiternaltermantaemployministrationserviceserve upservicingservicedservageserviceageenhancement overbalanceoverplusexcessincreasesurplusestablishmentsystemarrangementismorderorganisationnizamnizamssystemsfittingimplementmaterialnecessariesapparatusarticlesbaggageequipmentmaterielbelongingsbagginessburgagecommodoresconsumptsfuggiergugglesluggiepotagespuggareesstuffersstuffierstuffingsstuffstuggingswaresconsignaturewhetstonefireawayproposebidofferpresentproffershowsubmittenderportrayingprojectingput forwardobtendpresentingprosifyprenderpresentiateflounceliemaraudoverrunpillagewallowdepredateextortfakeflounderforagegibeharrylollplunderrifleriotrobsprawlwringdisplumeloavinglootenrewoundrobbingrevertentrevocateredoundingamassedassembledcapitalcollectiongatheredoutlaypluralaggregatedassembleassemblingcollectedlycollectivisedcollectivizedcomplectconglutinateconglutinationcongregatingcongruityaccorageaccruesaccumbencyagregationassegaiedassemblesassentscomplectedcomplectscomplottedcomportedconglobedcongreedcongruencycumulateddeposingdepositedgathersingatheredmusteredpluralisedpluralsplussedplussessummeredaccombinationaccrumentaugurationdepositurebootbribeemolumentpaybornclearcreateddiscoveredprocuredgeneratedgettingbehoofbenefitinterestleverageusefulnessvantageadvantageousnessbenefactbeneficbeneficebeneficiationgainfulnessavisementavisesavizesbenemptgainersgainsayswainageavailmentbeneficialnessbenemegainagerewethriftprofitsdividendsprofaceprofitingsresiduesavingsavoringsavouringdeavingsavagingsavatessavingnesssavoriesdeprivementsavablenesssavementproliferatebe bornfareflourishprevailsucceedoverweighexcelovercomesurpasstranscendwingelddoughedictfigurenumbermonesesamountedamountingsumszodiacsevictiongavelhomagetributegracebeneficenceprofusionhypothesispresumptionimplicatemoraladdictionroutinehabitabilityhabitushabituatesadustionhabiitancyhabilitationhabitaklehabitancehabituremoralscurrencyoutputoutturnconquertriumphwalk offwincingwinnowingswoninglauratewinsingpittanceappanagegrantpensionreligious broodingstipendtaskvocationstipelstipellatestipelsstipendsstipitesstipendiariesstipendiatestipitiformstipulaeproductionrationalismrationalisticdebatedemonstrationinductiondelectabilityreasonedreasonerreasoningreasoningsreliquairereasonistsupersedeeffectivenessimpressivenessimpetrationimpressionabilityimpressionablenesstactilefelt realisedsensedconquestsuccessvictorywinningwinningswinsomenesswinswonningwonswontingwynvanquishmentvinquishwinningnesswithdrawalrefundregressretourreversioncomebackcomeupancerepayablereturnablecomedownsrebutmentsrefashionsrefitmentrefitmentsrefitsrefundableretundingreturnerreturnersreturnsreembarkationrefossionrefutabilitywithdrawingwithdrawmentacquiringderivingconsequentialgive backbarngarnerbloomcanoncodeordinancereulecapitationpoll taxrecurregaindamagelosspunishmentretributioneffectsfindingsoncomesoutactsoutcomesoutjutsoutputsoutvaluesresalutesresultsrevaluesunfactsupshotsfinanceretracepay backpaying backgainst
Idioms with the word haasil - حاصل in it
Idioms related to the meaning of haasil - حاصل
What are the meanings of haasil - حاصل in English?
Meanings of the word haasil - حاصل in English are consequence, crop, custom, effect, gain, getting, illation, outcome, produce, sum, attained, attorn, duty, geta, harvest, inference, proceeds, product, realised, result, return, revenue, achieved, acquiesces, acquires, acquites, attains, attainted, attaints, attornment, avulsed, gained, gainsaying, gainst, garnered, gettered, gettings, grossed, obtains, yielded, attaintment and yieldance. To understand how would you translate the word haasil - حاصل in English, you can take help from words closely related to haasil - حاصل or it’s English translations. Some of these words can also be considered haasil - حاصل synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word haasil - حاصل. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use haasil - حاصل in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say haasil - حاصل in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of haasil - حاصل with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by حاصل?
Meanings of حاصل are consequence, crop, custom, effect, gain, getting, illation, outcome, produce, sum, attained, attorn, duty, geta, harvest, inference, proceeds, product, realised, result, return, revenue, achieved, acquiesces, acquires, acquites, attains, attainted, attaints, attornment, avulsed, gained, gainsaying, gainst, garnered, gettered, gettings, grossed, obtains, yielded, attaintment and yieldance
Whats the definition of حاصل?
Definition of the حاصل are
- feed as in a meadow or pasture
- a pouch in many birds and some lower animals that resembles a stomach for storage and preliminary maceration of food
- let feed in a field or pasture or meadow
- prepare for crops
- the stock or handle of a whip
- the output of something in a season
- a collection of people or things appearing together
- a cultivated plant that is grown commercially on a large scale
- the yield from plants in a single growing season
- cut short
- yield crops
- accepted or habitual practice
- habitual patronage
- a specific practice of long standing
- money collected under a tariff
- made according to the specifications of an individual
- the central meaning or theme of a speech or literary work
- an impression (especially one that is artificial or contrived)
- a symptom caused by an illness or a drug
- an outward appearance
- act so as to bring into existence
- produce
- win something through one's efforts
- earn on some commercial or business transaction; earn as salary or wages
- the amount by which the revenue of a business exceeds its cost of operating
- the amount of increase in signal power or voltage or current expressed as the ratio of output to input
- the advantageous quality of being beneficial
- a quantity that is added
- increase (one's body weight)
- obtain advantages, such as points, etc.
- derive a benefit from
- obtain
- rise in rate or price
- reach a destination, either real or abstract
- increase or develop
- the act of acquiring something
- the reasoning involved in drawing a conclusion or making a logical judgment on the basis of circumstantial evidence and prior conclusions rather than on the basis of direct observation
- something that results
- cause to happen, occur or exist
- the whole amount
- a set containing all and only the members of two or more given sets
- the final aggregate
- a quantity of money
- be a summary of
- determine the sum of
- a quantity obtained by the addition of a group of numbers
- achieved or reached
- acknowledge a new land owner as one's landlord
- a government tax on imports or exports
- work that you are obliged to perform for moral or legal reasons
- the social force that binds you to the courses of action demanded by that force
- footwear usually with wooden soles
- the yield from plants in a single growing season
- the season for gathering crops
- the gathering of a ripened crop
- the consequence of an effort or activity
- remove from a culture or a living or dead body, as for the purposes of transplantation
- the reasoning involved in drawing a conclusion or making a logical judgment on the basis of circumstantial evidence and prior conclusions rather than on the basis of direct observation
- the income or profit arising from such transactions as the sale of land or other property
- the set of elements common to two or more sets
- commodities offered for sale
- an artifact that has been created by someone or some process
- a quantity obtained by multiplication
- a consequence of someone's efforts or of a particular set of circumstances
- a chemical substance formed as a result of a chemical reaction
- successfully completed or brought to an end
- issue or terminate (in a specified way, state, etc.); end
- something that results
- a statement that solves a problem or explains how to solve the problem
- the semantic role of the noun phrase whose referent exists only by virtue of the activity denoted by the verb in the clause
- come about or follow as a consequence
- produce as a result or residue
- a quick reply to a question or remark (especially a witty or critical one)
- be inherited by
- give or supply
- bring back to the point of departure
- be restored
- answer back
- go back to something earlier
- the occurrence of a change in direction back in the opposite direction
- pass down
- a reciprocal group action
- pay back
- a coming to or returning home
- document giving the tax collector information about the taxpayer's tax liability
- the income or profit arising from such transactions as the sale of land or other property
- the act of someone appearing again
- getting something back again
- the act of going back to a prior location
- (American football) the act of running back the ball after a kickoff or punt or interception or fumble
- a tennis stroke that sends the ball back to the other player
- the key on electric typewriters or computer keyboards that causes a carriage return and a line feed
- happening again (especially at regular intervals)
- go back to a previous state
- make a return
- give back
- return in kind
- elect again
- submit (a report, etc.) to someone in authority
- go or come back to place, condition, or activity where one has been before
- return to a previous position; in mathematics
- the entire amount of income before any deductions are made
- government income due to taxation
What is the synonym of حاصل?
Synonym of word حاصل are جزا, انجام, نتیجہ, قدر, اعتبار, حاصل, خم یازہ, توڑنا, اُڑانا, کاٹنا
What are the idioms with the word حاصل?
Here are the idioms with the word حاصل in them.
- A friend is easier lost than found
- Carry one point
- World without end
- Come to nothing
- Come to one hand
What are the idioms related to حاصل?
Here are the idioms that are related to the word حاصل.
- Let the most difficult duty be your most sacred duty
- Dignity grows more easily than it obtains a beginning
- Every land does not produce everything
- Foolhardiness proceeds of ignorance
- He who ploughs reaps a good harvest