dhoka - دھوکا meanings in English
dhoka - دھوکا meanings in English are cheat, delusion, eye wash, fallacy, fallow, guile, hypocrisy, imposition, jape, lie, net, spoof, trick, trickery, deception, deceit, catch, chous, cross bite, feint, gimmick, illusion, juggle, mirage, misconceit, misgiving, misguidance, misrepresentation, mistake, stratagem, wile dhoka - دھوکا in English. More meanings of dhoka - دھوکا, it's definitions, example sentences, related words, idioms and quotations.
cheat delusion eye wash fallacy fallow guile hypocrisy imposition jape lie net spoof trick trickery deception deceit catch chous cross bite feint gimmick illusion juggle mirage misconceit misgiving misguidance misrepresentation mistake stratagem wile
dhoka - دھوکا Definitions
Please find 87 English and 4 Urdu definitions related to the word dhoka - دھوکا.
- (noun) : a drawback or difficulty that is not readily evident
- (verb) : grasp with the mind or develop an understanding of
- (noun) : a deception for profit to yourself
- (noun) : the act of swindling by some fraudulent scheme
- (noun) : someone who leads you to believe something that is not true
- (noun) : weedy annual native to Europe but widely distributed as a weed especially in wheat
- (noun) : weedy annual grass often occurs in grainfields and other cultivated land; seeds sometimes considered poisonous
- (verb) : deprive somebody of something by deceit
- (verb) : engage in deceitful behavior; practice trickery or fraud
- (verb) : be sexually unfaithful to one's partner in marriage
- (verb) : defeat someone through trickery or deceit
- (noun) : cultivated land that is not seeded for one or more growing seasons
- (adjective satellite) : left unplowed and unseeded during a growing season
- (adjective satellite) : undeveloped but potentially useful
- (noun) : a misconception resulting from incorrect reasoning
- (noun) : any distracting or deceptive maneuver (as a mock attack)
- (verb) : deceive by a mock action
- (noun) : a drawback or difficulty that is not readily evident
- (noun) : any clever maneuver
- (noun) : something unspecified whose name is either forgotten or not known
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (noun) : shrewdness as demonstrated by being skilled in deception
- (noun) : the quality of being crafty
- (noun) : insincerity by virtue of pretending to have qualities or beliefs that you do not really have
- (noun) : an expression of agreement that is not supported by real conviction
- (noun) : an illusory feat; considered magical by naive observers
- (noun) : something many people believe that is false
- (noun) : an erroneous mental representation
- (noun) : the act of deluding; deception by creating illusory ideas
- (noun) : the act of imposing something (as a tax or an embargo)
- (noun) : an uncalled-for burden
- (noun) : throwing and catching several objects simultaneously
- (noun) : the act of rearranging things to give a misleading impression
- (verb) : deal with simultaneously
- (verb) : manipulate by or as if by moving around components
- (verb) : throw, catch, and keep in the air several things simultaneously
- (verb) : hold with difficulty and balance insecurely
- (verb) : originate (in)
- (noun) : a statement that deviates from or perverts the truth
- (noun) : position or manner in which something is situated
- (noun) : Norwegian diplomat who was the first Secretary General of the United Nations (1896-1968)
- (verb) : be located or situated somewhere; occupy a certain position
- (verb) : have a place in relation to something else
- (verb) : be and remain in a particular state or condition
- (verb) : tell an untruth; pretend with intent to deceive
- (verb) : be lying, be prostrate; be in a horizontal position
- (verb) : assume a reclining position
- (noun) : something illusory and unattainable
- (noun) : an optical illusion in which atmospheric refraction by a layer of hot air distorts or inverts reflections of distant objects
- (noun) : painful expectation
- (noun) : uneasiness about the fitness of an action
- (noun) : a willful perversion of facts
- (noun) : a misleading falsehood
- (verb) : yield as a net profit
- (verb) : make as a net profit
- (noun) : the excess of revenues over outlays in a given period of time (including depreciation and other non-cash expenses)
- (adjective satellite) : conclusive in a process or progression
- (noun) : a trap made of netting to catch fish or birds or insects
- (noun) : game equipment consisting of a strip of netting dividing the playing area in tennis or badminton
- (noun) : a goal lined with netting (as in soccer or hockey)
- (noun) : a computer network consisting of a worldwide network of computer networks that use the TCP/IP network protocols to facilitate data transmission and exchange
- (verb) : catch with a net
- (verb) : construct or form a web, as if by weaving
- (adjective) : remaining after all deductions
- (noun) : a composition that imitates or misrepresents somebody's style, usually in a humorous way
- (noun) : a maneuver in a game or conversation
- (noun) : an elaborate or deceitful scheme contrived to deceive or evade
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (noun) : the act of deceiving
- (noun) : a misleading falsehood
- (noun) : the quality of being fraudulent
- (noun) : an illusory feat; considered magical by naive observers
- (noun) : the act of deceiving
- (noun) : a misleading falsehood
- (noun) : the act of deluding; deception by creating illusory ideas
- (noun) : a mistaken or unfounded opinion or idea
- (noun) : (psychology) an erroneous belief that is held in the face of evidence to the contrary
- (noun) : a humorous anecdote or remark intended to provoke laughter
- (noun) : an illusory feat; considered magical by naive observers
- (verb) : deceive somebody
- (noun) : a prostitute's customer
- (noun) : a cunning or deceitful action or device
- (noun) : an attempt to get you to do something foolish or imprudent
- (noun) : a period of work or duty
- (noun) : (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (noun) : verbal misrepresentation intended to take advantage of you in some way
- ہَل جوتنے کے بَعد چھوڑی گئی ذَمِين
- بعد وضع اخراجات وغیرہ جو باقی رہے
- حصولِ مقصد کے لیے سوچی سمجھی چال حیلہ
- خصوصاً دشمن کو فریب دینے کے لیے جنگی حکمت عملی
Example Sentence
They don't cheat | وہ دھوکا نہیں دیتے ہیں |
More words related to the meanings of dhoka - دھوکا
More words from English related to dhoka - دھوکا
View an extensive list of words below that are related to the meanings of the word dhoka - دھوکا meanings in English in English.
absolutelybarelynetquitesincereunadulteratedutteracceptcatchgettakeobtainundergolenasoaksoak upsoakageacidblundererrorfalling fault fiascofourguiltmisconceitmisgivingomissionparkagoraneglectquadrivialsquarevenial sinwrongyardchocsquarkquartesquareschoakaffectationartificialityconstructionconcoctionconformationdispositionedificationequipmentface ... falsification feignfeint fictionfigmentforgingmakemanufacturenatureshamtextureaffectblandishmentconstitutionexaggerationfabricmake upmakingputting on airssimulationstructurestructuraltexturedtextlesstexturestexturingtexturisetexturisedtexturisestexturizedtexturizespharisaismbunkclaptraphypocrisyinsincerityostentationplausibilityshowappearanceaffixappendapplycementdaubfixhookimplantimpositionimputeimpressmoorscaffoldssembleapposearrangeattachbeginconnecthitimponeimposeinflictinsertinstallinstatejoinplantpushreachenlaceembalingaffrightawedismaydreadfrighthorrorterrorapprehensionconsternationdangerfearfearfulnessinsecurityintimidationperilappointmentfoundation appointeeappointiveappointingappensionapprehendcaptureentrammel grabgraspgripholdnailsniggleclutchcopdetectdiscovergripehaulhitchpreventseizetweezeclutchinggrabbinggrabblingwinchingimplicateshoparrestartfulnessimposturejugglerymachinationmanoeuvreslinesscircumventiondeceptionguilequackerypearlinesspreposterousrusecreationdeceitinstinctintriguesagacitywisdominherencyinnatenessnaturismnatalitiesnatiformnaturesconnaturalityconnaturalnessnaturalitynaturelessnaturitychouscross bitehoaxillusionjugglelegerdemaincheatingdeceivingdouble dealingfallowfraudgriftliemountebankeryspooftricktrickerywilewilfulnessdelusivewilefuldecededecencedesudationcheathuskartificialfalseimitativemockspuriousbastardboguscontriveddudfabricatedfactitiousfakepostichepseudorecordedshoddytraditionalunnaturalunorignalduplicitoussimulatedfacinorousimmingledimpingentmimeticalsimulantsimulantssimulatessimulatingsimulatorycentuplicatedduplicativereduplicativebadinagejapefacetiousnessfungustojestjokejokingludificationquizrailleryderisiondrollerygaghumourjocularitylikingmockerypleasantryrelishscofftastewitbanterfunninessgybejest atkiddmock uppoke funprankishbecalmscynicsfunkingfunnierfunsgiddyingjestingsjoukingjustedkiddieskiddingmockadoesmockingsmocksmokesprancingsprankfulprankingprankingsprankspranksomeprankymocklebandagecompressfarmgirthholdingligamenligaturetableteachingtenurebandbeltclampdeligationeye washheadbandinklekerseylathlinelistpartplasterpositionrandribbonrowscreedstrapstripstripetabtapethongzonestipestreepputtistripierstripingsstroutyirdedpateestrippetstryphnicforgetmistakemisserrmisstepslitherillaqueatingerreminisecrimefobilemisadventuremisapprehensionmisdeedmisdoingsinwrongdoingsbevuedelictfallacyiniquitylapseoversightsliptransgressionmiscalculationdelusioninaccuracymiscarriagemisprisionmistakennessmisunderstandingobliquityerrancyerroneousnessfaultingfaultlessnessimprecisionmisgaugemistakingwrongnesserningerrantryerrantserroristerroristsfalsitiesfaultedmisallegesmistaughtmistuneerrantiaerrationerrorfulevulgateincorrectionmisgiemiskeepmisthrowmistionmistrowmisturnpick faultburdensomenessdraft entranceencumbranceoverpressureproduceburdenchancegriefliabilityloadobstacleoccasiononusopportunitypermissionraintimeturnweightcaptiveapprehendedarresteearrestedcaptivatedcapturedinvolvedprisonerseizedsmittenmaintainmoderateceremonialcraftgadgetmotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomfashiongaitgimmickryindirectionshenaniganstratagemtacticwalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackedge flexionforcing pumptagtailwhiffbrawnbreathcourageendenergyextremitygutheftimpetusinertiainstantlifemightmomentpneumatailtempertugvitalityzaptailletrapbluffblackmailbullyinghighhandednessbullarydisloyaltychicanerydouble crossdeceptivenessdeceptivityvitilitigationcharcoalfalliblebetrayalwaterdiversion duplicityhoodwinkingsophistryburnscircumlocutiondifferenceturningwindingconfessedlydiffidencemistrustfulnessquandarydemurdistrust doubthesitancehesitationincertitudemistrustscepticismscruplesuspicionuncertaintysuspiciousnessdoubtscontaminationdraff falsehoodfeignedlyhumbuglyingmisrepresentationbragcounterfeitinveracitymendacityuntruthfalsenessuntruthfulnessfalsehoodsliegedomliegeslieslieusuntruthsfalnessliascorruptcorruptedfeloniousnefariousdefectivedishonestfaultyfraudulentinfamousphoneyspitefulcouchlairlatinaelightreposerestunbendresittingrestatingrestringrestylingevasion ear ring minoroveraboveloftymadultrauponyoungsterbalasballowcruxentanglementgruelimplexionimplicationkinkwater gruelcoilcomplicationconjeecurlcurvedifficultyfoldindirectnessintorsionnullscrewslewtorsiontwistvolutionwimplepaschpatchedpatchingpatchoulyschlockscrewingbachingleachesmatchetspatchespatchingspatchworkspaunchespechpechsperchingpleuchscreaksscreechesscreichscreighscrewerscrewingsscrewsscrowsscutchscutchesspewstachesboltcuremakeshifttactadvicearrangementartificedeliberationdevicegimmickginopinionorderplanpolicygradualitymaneuverabilitymanoeuvrabilitytacticaltractarianismgradinetactualityplacitorystipulasustulatecustomstaxdutyfreight impostlevyscattarifftaxationtollyieldrevenuesjeopardythreatventurehazardmenacepitfallriskdangerousnesshazardousnessperilousnessperiluneperipetyriskinessrisklessnesshazardedhazardinghazardryhazersjeopardermenacesterretshazarderheresiographyjeopardingmuseobsessconcernconsiderationthoughtworrydiddlehypelurchmisgivemisleadoutwitswindlebafflebamboozlebefoolbeguilebilkbumbazechicanecogdeceivedefrauddeludedodgedupefoolfoxfudgegyphoodwinkjockeynobbleshortshortchangealarmpalpitationqualmthrushesfaddismfancyfantasmfantasyideaimaginationobsessionsuperstitionvagarywhimwhimsyillusionaldelusionsillusionswhamecapriceskepticaldigressionfalse stepshakingslippageslippingtotteringdisbelieverfaithlessimmoralshonkyjacklegnullifidianperfidiousunconscionableunfairunfaithfulunprincipledwide boyrascalmalpractitionerunreliabledisport dissembling guilefulillusiveimpostorknavishriggershiftybamboozlercunningdeceitfuldeceiverdodgerdodgygnosticillusoryimposterinsidiousinsinceremisleadermountebanktrickstertrickywilfulfreebeedissimilar genuinegrotesqueimpertinentrhapsodicdisaffectedsqueamishunalloyedunconnectedcircledilemmamazemisfortunerevolutionyawndragsnarevertigoentrapmentgridlatchplexustoiltrepanwebreticulumjollreticuladrink miragealcoholboozeliquorvinowinebooze uptequilavenulewhiskeywhiskywinepresswineskinboozesbreamsbrewsliquesceliquescesliquescingliquoricesliquorstequilaswinedwineswiningliquorouswinelessegregiouserroneousimpropermisawrydelusionalflawedinaccurateincorrectmistakenunduewrongfulamissfauxfoul outimpreciselymalposedmiscuemisestimatemismatederrederumpentmisaimmisaimedmisalignedmisalliedmiscalledmiscuedmiscuingmisdatedmisdialmisdidmiseremiseresmisesmisfittedmisformedmisintendmiskeyedmispleasedmisquotedmisratedmisratesmisratingmisseemistedmisteredmistiermistimedmiswentperjuriousperjurouswrongingwrongouseversefalwemiskenmisrendermisrepeatmisseekmiswedmisyuncorrectenchafefashfingergallribtampervexwantonannoydisturbfillipirritatekidmolestnettletauntteasetickletamp downtease aparttee offteeterchafferingtaffetytamesttampingtattersteadteadeteamerteaselingteasellingteasesteeteringteindingtetteringtewarttotherscastigatingirroratemuriculatetabefactionentrapensnareensnaredvictimizeentangleinvolvepuzzlementdiscomfortimbrogliolabyrinthmessmorassperplexityrestlessnesstangleconfusednessconfoundednessoblivionforgetfulnessforgettingforgotpretextalibicauseexcusemaskpretencesalvostalepretexfabulousfallacious feigned fictitiousgroundlessknaveliaroscillationslanderousalloyedbraggartduplictioushalf eateninconsistentmendaciousuntrueuntruthfulvainfalselyfalsestlierliadpitchappearbetidedrop encampenterfallhappeninterferemediatesitsleepstaysuffersuitintracranialmisleadingfalsityshammershifterfelondeceiversdeludershallucinationfishing netmoneybaitbidconspiracycostdecoyloanpricevalueflouncemaraudoverrunpillagewallowdepredateextortfleeceflounderforagegibeharrylollplunderreturnrifleriotrobsprawlwringdisplumeloavinglootenrewoundrobbingrevertentrevocateredoundingpurefairfine immaculateincorruptinviolatemerenativeneatultimateunblemishedvirginvirginitynettedpuracepureenettiestpuredpureedpureespurerpurespurtiervellicatedglamourjugglinggrudgehostilityaffectionaffinityanimosityantagonismattachmentcorrelationill feelingloveplotrelationrelevancyloggedisguise quibblegullhocuswheedlemake believevictimisemalevolencemalicerancourmischiefwickednessprestidigitationconfinementdetentionhouse arrestinternmentsleightplay tricksknaverydesidiousdesidiousnessprevaricatelying inliaisinglyinglymisrepresentmisstatemistellwelshassistcurbhelphold uplook aftermanagepunishretrieveset rightsupportsustaintake care oftake overembalmmentmixturesynthesiscompositionconfigurationdecoctioninventionmethodmoderecipesyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismwaitinningmurderambushmayamoolahmaiamyamisacceptationmisconceptionmisundersandingergodicityfallaciousnessmisperceivemisreckoningmisunderstoodperjurersubornation of perjurymisceginemiscontentmisdrewmisfaithmisfallmisfeasormisgraftmisknewmisknowmisknowingmisluckmisrulingmistunedmistuningmisweeningmiswordingdelinitioninunderstandingmisadvertencemisallotmentmiscensuremischoosingmischosemischosenmiscibilitymisconceivermisconceivingmisconclusionmisconsecrationmisconsequencemisconstruablemisconstruingmisdispositionmisdivisionmisexplanationmisexplicationmisfallingmisfeelingmisformationmisimaginationmisintelligencemisjudgmentmismeasurementmisordinationmisperceptionmisreligionmisunderstandermiszealousmisallegationmisdatingmisestimationmisrepresentedmisadvisesmisallegedmisallotmisandristmisbestowmiscastedmisericordmislabelmisorderedmisplacingmisplantmisseeingmisseemingmissettingmisstatingmistellingmisweenedmisbilevemisconsecratemisrecollectionmisrepresentativemisstayedmistreadingmisrepresentaationmisconjecturemisguidanceaberrationdivagationheresymisguidednessmislaidmisarrayedmisgoesmisgoingmisguidesmisguidingmislayingmisleadsmislitmisplayedmispleadmisroutedevulgationmisgovernancemisguessmislearnmisletoemislingmisunderstandironysarcasmmulctdamagepenaltyransomnettinggauzegrategrillelatticemeshprotrateuncultivatedseductiontemptationinstigationtemporizationcotemporarytergiversatebunkumfablefibfrivolous talkairscoquetryflirtingswaggerbeguilementlosschacmabotchbunglecarry offjumpleapdishonourcoaxinveigleseduceflatterdiscrepancyclevernesscompensationdemurrageforfeitindemnityquittanceretaliationdabmopmagicmiracledeluderquackfeigningpretentionderidegecklaugh atmake funnoosejealousyhypocalcaemiahypocorismhypopityshypocausthypocaustsfrictiongashhackquipquirkvaingloryoptical illusionloomingelusionabusionrheaevicissitudewagerdauwsleight of hand
Idioms with the word dhoka - دھوکا in it
Idioms related to the meaning of dhoka - دھوکا
What are the meanings of dhoka - دھوکا in English?
Meanings of the word dhoka - دھوکا in English are catch, cheat, chous, cross bite, fallow, fallacy, feint, gimmick, guile, hypocrisy, illusion, imposition, juggle, lie, mirage, misconceit, misgiving, misguidance, misrepresentation, mistake, net, spoof, stratagem, wile, deceit, deception, delusion, jape, trick, trickery and eye wash. To understand how would you translate the word dhoka - دھوکا in English, you can take help from words closely related to dhoka - دھوکا or it’s English translations. Some of these words can also be considered dhoka - دھوکا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word dhoka - دھوکا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use dhoka - دھوکا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say dhoka - دھوکا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of dhoka - دھوکا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by دھوکا?
Meanings of دھوکا are catch, cheat, chous, cross bite, fallow, fallacy, feint, gimmick, guile, hypocrisy, illusion, imposition, juggle, lie, mirage, misconceit, misgiving, misguidance, misrepresentation, mistake, net, spoof, stratagem, wile, deceit, deception, delusion, jape, trick, trickery and eye wash
Whats the definition of دھوکا?
Definition of the دھوکا are
- a drawback or difficulty that is not readily evident
- grasp with the mind or develop an understanding of
- a deception for profit to yourself
- the act of swindling by some fraudulent scheme
- someone who leads you to believe something that is not true
- weedy annual native to Europe but widely distributed as a weed especially in wheat
- weedy annual grass often occurs in grainfields and other cultivated land; seeds sometimes considered poisonous
- deprive somebody of something by deceit
- engage in deceitful behavior; practice trickery or fraud
- be sexually unfaithful to one's partner in marriage
- defeat someone through trickery or deceit
- cultivated land that is not seeded for one or more growing seasons
- left unplowed and unseeded during a growing season
- undeveloped but potentially useful
- a misconception resulting from incorrect reasoning
- any distracting or deceptive maneuver (as a mock attack)
- deceive by a mock action
- a drawback or difficulty that is not readily evident
- any clever maneuver
- something unspecified whose name is either forgotten or not known
- the use of tricks to deceive someone (usually to extract money from them)
- shrewdness as demonstrated by being skilled in deception
- the quality of being crafty
- insincerity by virtue of pretending to have qualities or beliefs that you do not really have
- an expression of agreement that is not supported by real conviction
- an illusory feat; considered magical by naive observers
- something many people believe that is false
- an erroneous mental representation
- the act of deluding; deception by creating illusory ideas
- the act of imposing something (as a tax or an embargo)
- an uncalled-for burden
- throwing and catching several objects simultaneously
- the act of rearranging things to give a misleading impression
- deal with simultaneously
- manipulate by or as if by moving around components
- throw, catch, and keep in the air several things simultaneously
- hold with difficulty and balance insecurely
- originate (in)
- a statement that deviates from or perverts the truth
- position or manner in which something is situated
- Norwegian diplomat who was the first Secretary General of the United Nations (1896-1968)
- be located or situated somewhere; occupy a certain position
- have a place in relation to something else
- be and remain in a particular state or condition
- tell an untruth; pretend with intent to deceive
- be lying, be prostrate; be in a horizontal position
- assume a reclining position
- something illusory and unattainable
- an optical illusion in which atmospheric refraction by a layer of hot air distorts or inverts reflections of distant objects
- painful expectation
- uneasiness about the fitness of an action
- a willful perversion of facts
- a misleading falsehood
- yield as a net profit
- make as a net profit
- the excess of revenues over outlays in a given period of time (including depreciation and other non-cash expenses)
- conclusive in a process or progression
- a trap made of netting to catch fish or birds or insects
- game equipment consisting of a strip of netting dividing the playing area in tennis or badminton
- a goal lined with netting (as in soccer or hockey)
- a computer network consisting of a worldwide network of computer networks that use the TCP/IP network protocols to facilitate data transmission and exchange
- catch with a net
- construct or form a web, as if by weaving
- remaining after all deductions
- a composition that imitates or misrepresents somebody's style, usually in a humorous way
- a maneuver in a game or conversation
- an elaborate or deceitful scheme contrived to deceive or evade
- the use of tricks to deceive someone (usually to extract money from them)
- the act of deceiving
- a misleading falsehood
- the quality of being fraudulent
- an illusory feat; considered magical by naive observers
- the act of deceiving
- a misleading falsehood
- the act of deluding; deception by creating illusory ideas
- a mistaken or unfounded opinion or idea
- (psychology) an erroneous belief that is held in the face of evidence to the contrary
- a humorous anecdote or remark intended to provoke laughter
- an illusory feat; considered magical by naive observers
- deceive somebody
- a prostitute's customer
- a cunning or deceitful action or device
- an attempt to get you to do something foolish or imprudent
- a period of work or duty
- (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- the use of tricks to deceive someone (usually to extract money from them)
- verbal misrepresentation intended to take advantage of you in some way
- ہَل جوتنے کے بَعد چھوڑی گئی ذَمِين
- بعد وضع اخراجات وغیرہ جو باقی رہے
- حصولِ مقصد کے لیے سوچی سمجھی چال حیلہ
- خصوصاً دشمن کو فریب دینے کے لیے جنگی حکمت عملی
What is the synonym of دھوکا?
Synonym of word دھوکا are پکڑنا, لینا, تھامنا, گرفتار کرنا, گرفتار, پھانس لینا, پھانسنا, سنبھالنا, اچکنا, دھوکا
What are the idioms with the word دھوکا?
Here are the idioms with the word دھوکا in them.
- Do not leave the right path and you are safe
- He who trusts to the promises of others is often deceived
- Jockey
- To juggle with
- Sell smoke
What are the idioms related to دھوکا?
Here are the idioms that are related to the word دھوکا.
- Hypocrisy pays
- Know yourself and your neighbours will not mistake you
- To juggle with
- Cheat me in the price but not in the goods
- It is a double pleasure to cheat the cheater
How to use دھوکا in a sentence?
Here are few examples on how to use دھوکا in a sentence.
- They don't cheat — وہ دھوکا نہیں دیتے ہیں