chhorna - چھوڑنا meanings in English
chhorna - چھوڑنا meanings in English are discede, relinquish, release, quit, pardon, let go, leave, give up, forsake, render, resign, set aside, quitting, quiting, forslack, disendow, abjoint, yield, spare, shoot, evict, ditch, discharge, evacuate, eschew, emancipate, emit, divorce, disuse, acquisition, abstain, forgive, forgo, let, desert, avoid, abdicate, abandon, waive, vent, omit, liberate, absolve chhorna - چھوڑنا in English. More meanings of chhorna - چھوڑنا, it's definitions, example sentences, related words, idioms and quotations.
discede relinquish release quit pardon let go leave give up forsake render resign set aside quitting quiting forslack disendow abjoint yield spare shoot evict ditch discharge evacuate eschew emancipate emit divorce disuse acquisition abstain forgive forgo let desert avoid abdicate abandon waive vent omit liberate absolve
chhorna - چھوڑنا Definitions
Please find 219 English and 4 Urdu definitions related to the word chhorna - چھوڑنا.
- (noun) : a feeling of extreme emotional intensity
- (verb) : give up with the intent of never claiming again
- (verb) : forsake, leave behind
- (verb) : leave someone who needs or counts on you; leave in the lurch
- (verb) : leave behind empty; move out of
- (noun) : the trait of lacking restraint or control; reckless freedom from inhibition or worry
- (verb) : stop maintaining or insisting on; of ideas or claims
- (verb) : give up, such as power, as of monarchs and emperors, or duties and obligations
- (verb) : grant remission of a sin to
- (verb) : refrain from voting
- (verb) : choose not to consume
- (noun) : an ability that has been acquired by training
- (noun) : the act of contracting or assuming or acquiring possession of something
- (noun) : something acquired
- (noun) : the cognitive process of acquiring skill or knowledge
- (verb) : prevent the occurrence of; prevent from happening
- (verb) : refrain from doing something
- (verb) : stay clear from; keep away from; keep out of the way of someone or something
- (verb) : refrain from certain foods or beverages
- (verb) : declare invalid
- (verb) : pronounce not guilty of criminal charges
- (verb) : complete or carry out
- (noun) : the act of discharging a gun
- (noun) : the act of venting
- (noun) : the sudden giving off of energy
- (noun) : any of several bodily processes by which substances go out of the body
- (noun) : a substance that is emitted or released
- (noun) : a formal written statement of relinquishment
- (noun) : the termination of someone's employment (leaving them free to depart)
- (verb) : release from military service
- (verb) : pour forth or release
- (verb) : remove the charge from
- (verb) : become empty or void of its content
- (verb) : cause to go off
- (verb) : go off or discharge
- (verb) : eliminate (a substance)
- (verb) : remove (cargo, people, etc.) from and leave
- (noun) : the state of something that has been unused and neglected
- (verb) : part; cease or break association with
- (noun) : the legal dissolution of a marriage
- (verb) : get a divorce; formally terminate a marriage
- (verb) : throw away
- (noun) : a long narrow excavation in the earth
- (noun) : any small natural waterway
- (verb) : forsake
- (verb) : crash or crash-land
- (verb) : make an emergency landing on water
- (verb) : sever all ties with, usually unceremoniously or irresponsibly
- (verb) : cut a trench in, as for drainage
- (verb) : expel (gases or odors)
- (verb) : give off, send forth, or discharge; as of light, heat, or radiation, vapor, etc.
- (verb) : express audibly; utter sounds (not necessarily words)
- (verb) : give equal rights to; of women and minorities
- (verb) : free from slavery or servitude
- (verb) : expel from one's property or force to move out by a legal process
- (verb) : expel or eject without recourse to legal process
- (verb) : excrete or discharge from the body
- (verb) : empty completely
- (verb) : move out of an unsafe location into safety
- (verb) : move people from their homes or country
- (verb) : create a vacuum in (a bulb, flask, reaction vessel)
- (verb) : absolve from payment
- (verb) : stop blaming or grant forgiveness
- (verb) : do without or cease to hold or adhere to
- (verb) : lose (s.th.) or lose the right to (s.th.) by some error, offense, or crime
- (noun) : permission to do something
- (noun) : the act of departing politely
- (verb) : leave behind unintentionally
- (noun) : the period of time during which you are absent from work or duty
- (verb) : remove oneself from an association with or participation in
- (verb) : act or be so as to become in a specified state
- (verb) : have left or have as a remainder
- (verb) : be survived by after one's death
- (verb) : go and leave behind, either intentionally or by neglect or forgetfulness
- (verb) : leave unchanged or undisturbed or refrain from taking
- (verb) : go away from a place
- (verb) : put into the care or protection of someone
- (verb) : leave or give by will after one's death
- (verb) : move out of or depart from
- (verb) : transmit (knowledge or skills)
- (verb) : produce as a result or residue
- (verb) : cause to move; cause to be in a certain position or condition
- (verb) : grant use or occupation of under a term of contract
- (noun) : a serve that strikes the net before falling into the receiver's court; the ball must be served again
- (verb) : leave unchanged
- (verb) : actively cause something to happen
- (noun) : a brutal terrorist group active in Kashmir; fights against India with the goal of restoring Islamic rule of India
- (verb) : give equal rights to; of women and minorities
- (verb) : grant freedom to
- (verb) : release (gas or energy) as a result of a chemical reaction or physical decomposition
- (verb) : leave undone or leave out
- (verb) : prevent from being included or considered or accepted
- (noun) : a warrant granting release from punishment for an offense
- (noun) : the formal act of liberating someone
- (verb) : grant a pardon to
- (verb) : accept an excuse for
- (verb) : go away or leave
- (verb) : put an end to a state or an activity
- (verb) : give up or retire from a position
- (verb) : turn away from; give up
- (verb) : give up in the face of defeat of lacking hope; admit defeat
- (verb) : run or move very quickly or hastily
- (verb) : spend frivolously and unwisely
- (verb) : make a film or photograph of something
- (verb) : produce buds, branches, or germinate
- (verb) : record on photographic film
- (verb) : kill by firing a missile
- (verb) : hit with a missile from a weapon
- (noun) : the act of shooting at targets
- (noun) : a new branch
- (verb) : send forth suddenly, intensely, swiftly
- (verb) : cause a sharp and sudden pain in
- (verb) : emit (as light, flame, or fumes) suddenly and forcefully
- (verb) : measure the altitude of by using a sextant
- (verb) : utter fast and forcefully
- (verb) : score
- (verb) : fire a shot
- (verb) : throw dice, as in a crap game
- (verb) : variegate by interweaving weft threads of different colors
- (verb) : throw or propel in a specific direction or towards a specific objective
- (verb) : give an injection to
- (verb) : force or drive (a fluid or gas) into by piercing
- (noun) : a score in tenpins; knocking down all ten after rolling two balls
- (noun) : an extra car wheel and tire for a four-wheel vehicle
- (noun) : an extra component of a machine or other apparatus
- (verb) : give up what is not strictly needed
- (verb) : save or relieve from an experience or action
- (verb) : use frugally or carefully
- (adjective satellite) : thin and fit
- (adjective satellite) : kept in reserve especially for emergency use
- (adjective satellite) : more than is needed, desired, or required
- (adjective satellite) : lacking embellishment or ornamentation
- (adjective satellite) : lacking in magnitude or quantity
- (verb) : expose to cool or cold air so as to cool or freshen
- (noun) : external opening of urinary or genital system of a lower vertebrate
- (noun) : a hole for the escape of gas or air
- (noun) : a slit in a garment (as in the back seam of a jacket)
- (noun) : a fissure in the earth's crust (or in the surface of some other planet) through which molten lava and gases erupt
- (verb) : give expression or utterance to
- (noun) : activity that frees or expresses creative energy or emotion
- (verb) : do without or cease to hold or adhere to
- (verb) : lose (s.th.) or lose the right to (s.th.) by some error, offense, or crime
- (verb) : be the cause or source of
- (noun) : an amount of a product
- (verb) : give or supply
- (verb) : be flexible under stress of physical force
- (verb) : move in order to make room for someone for something
- (noun) : production of a certain amount
- (noun) : the quantity of something (as a commodity) that is created (usually within a given period of time)
- (verb) : bring in
- (verb) : be fatally overwhelmed
- (verb) : consent reluctantly
- (verb) : give in, as to influence or pressure
- (verb) : cease opposition; stop fighting
- (verb) : cause to happen or be responsible for
- (noun) : the income or profit arising from such transactions as the sale of land or other property
- (verb) : end resistance, as under pressure or force
- (verb) : leave someone who needs or counts on you; leave in the lurch
- (noun) : arid land with little or no vegetation
- (verb) : leave behind
- (verb) : desert (a cause, a country or an army), often in order to join the opposing cause, country, or army
- (noun) : (usually plural) a person's deservingness of or entitlement to reward or punishment
- (verb) : leave someone who needs or counts on you; leave in the lurch
- (verb) : give up with the intent of never claiming again
- (verb) : put an end to a state or an activity
- (verb) : stop consuming
- (verb) : give up in the face of defeat of lacking hope; admit defeat
- (verb) : give up what is not strictly needed
- (verb) : allow the other (baseball) team to score
- (verb) : relinquish possession or control over
- (verb) : give up or agree to forgo to the power or possession of another
- (verb) : stop maintaining or insisting on; of ideas or claims
- (verb) : lose (s.th.) or lose the right to (s.th.) by some error, offense, or crime
- (verb) : leave (a job, post, or position) voluntarily
- (verb) : be relaxed
- (verb) : release, as from one's grip
- (noun) : a legal document evidencing the discharge of a debt or obligation
- (noun) : a formal written statement of relinquishment
- (noun) : the termination of someone's employment (leaving them free to depart)
- (noun) : the act of liberating someone or something
- (verb) : generate and separate from cells or bodily fluids
- (noun) : the act of allowing a fluid to escape
- (verb) : prepare and issue for public distribution or sale
- (noun) : a device that when pressed will release part of a mechanism
- (noun) : euphemistic expressions for death
- (verb) : eliminate (a substance)
- (verb) : release (gas or energy) as a result of a chemical reaction or physical decomposition
- (verb) : make (information) available for publication
- (noun) : an announcement distributed to members of the press in order to supplement or replace an oral presentation
- (noun) : (music) the act or manner of terminating a musical phrase or tone
- (noun) : activity that frees or expresses creative energy or emotion
- (noun) : merchandise issued for sale or public showing (especially a record or film)
- (noun) : a process that liberates or discharges something
- (verb) : let (something) fall or spill from a container
- (verb) : release, as from one's grip
- (verb) : do without or cease to hold or adhere to
- (verb) : turn away from; give up
- (verb) : release, as from one's grip
- (verb) : give or supply
- (verb) : bestow
- (verb) : show in, or as in, a picture
- (verb) : make over as a return
- (verb) : restate (words) from one language into another language
- (verb) : pass down
- (verb) : to surrender someone or something to another
- (verb) : give something useful or necessary to
- (verb) : give an interpretation or rendition of
- (noun) : a substance similar to stucco but exclusively applied to masonry walls
- (verb) : cause to become
- (verb) : melt (fat or lard) in order to separate out impurities
- (verb) : coat with plastic or cement
- (verb) : give back
- (verb) : give up or retire from a position
- (verb) : accept as inevitable
- (verb) : leave (a job, post, or position) voluntarily
- (adjective satellite) : reserved in advance
- (verb) : give or assign a resource to a particular person or cause
- (verb) : make inoperative or stop
- (verb) : annul (a legal decision)
- ایسا نالہ جو سیم کا پانی سُونتنے کے لیے کھودا جاۓ
- بذریعہ حکم عدالت بے دخل کرنا
- پابَندی يا قيد سے آزاد کَرنا
- جو عورت قانونی حفاظت سے باہر ہو
More words related to the meanings of chhorna - چھوڑنا
More words from English related to chhorna - چھوڑنا
View an extensive list of words below that are related to the meanings of the word chhorna - چھوڑنا meanings in English in English.
abandonapathycarelessnessdisregardneglectfulnessnegligenceabandonmentirresponsibilitydivorce evacuationwaiverdisuse abrogationdiscontinuationobsolescenceturkabdicateeschew waiveabdicationabruptiondisengagementdisjunctiondismissaldissolutiondistinctnessdisuniondivarication disposalegressneutralityseclusionseveraltyseverancebreak updislocationisolationpartingsecessionseparationdemarcationbreakupdetachableseparatenessseparatrixsecessionsseclusionsseparatumseparatumseliquation ... sepelitionseptentrionseptentrionalitysepulcheringquarantinedabsolvedisenthrallemancipatequitacquitacquitingacquitmentacquittingacquisitionliberatereleaseunbindabstainceaseshunescapeeschewinghidefardingshirking workavoidforbearrefrainabstainingabstainsrefrainingabstinenceairlessbandagebankbreakwatercrampdamimpassableimprisonmentjointletligamenligaturemanacleobstaclepiecepierbondclosedcopuladikedykehoopligamentshuttightunopenedverseweirbound offclose downclose offclose outclosedowncloselippedcloseoutclosingclosing offdiscontinuedetchedfoist offoffhandedshut awayshutoutshutteredshuttingspiel offceasingclosetedclosetingclosuredcloyedestopinclosesoffedoffingsquitedseinedshutsunclosedclosehandedclosehauledcollopedabstractcutoffdiscard disconnectdisembodydisemploy disengagedisjoin dispart disseverdistractdistingusishsheardetachdislocatedisplacedistinguishinsulateisolateretiresecludesegregateseparatesequesterseverunfastenunfixaltercatedesalinatedisassociationdissociatedissociationseptateseptationseveringalginatedisseatingportioningseparatingseptuplingalacrifyinsociateobolizesegregatingdiscriminatecleaveset asidewinnowfork outdetachesdetuncateseptentrionateabutaffectfastenimpingevegetateadhereapplyto be attachedbeginfeel hitknockperceivereachrelishseemshootsproutstickstrikestrucksuittastetouchlagunaluggingabnegateabsolutionapologyforgiveness immunityexculpationpardonremissionapogamyapologiaapomictexoneratedexonerationforgivablyforgivingnesspardonablyremissnesssardonicallyamnestiedamnestiesamnestyingapismexcoriateslibatedpardiepardoningspardonspardyremissionssardonicalamissibilityapiculatedexcommunicatedexcommunionexfoliatingexinanitionexpletionexuperanceexuperationforleavepardonablenessin remissionclemencydeliveranceexemptionfreedomliberationredemptionreliefstevedoreabactinalabatesdischargelessenmitigatemoderatelighten upslightingmildeningslightenaccedeacquiescecommemorationconcededisbelieve homologatemindvenerateyieldacceptacknowledgeadmitaffordagreeallowassumebelieveconsentholdkeepobeyreceiveregardadmissiveaccededadeemingadhibitadhibitingadhibitsadmixingconceivingconjectobequitatesupputateavowdeferrendersurrenderacknowsubmissaccreditingacknowledgingaccessgangwaygateroutetrackventwaycoursecustomheadwayjourneymethodpathprogressroadroadmapwentacteffectuate doacquittedterreneabjectbrieacquitsacquittalsbraysaffixarrestencumber hookattachengageimpedeembattlingaffiliatearisecreateengender fatherfindgaingenerategrowmakemanufacturespropagateswakenacquirebreedearnelicitgendergetinventmanifestprocreateprocureproduceteemarousinggeneratingingenerateproducingair cellcrevice crannyholeleakmortiseopeningborehollowinletmouthpassagevacancyperforatedperforationholesopeningsostiolesapproacharrivalimportimportationmuseadventcomingvisitarriagearriagesarrivalsarrivancearrivismearrivistesinflowsinfluxesinfluxioninfluxionstoomingconfinedissuadeimmanacleobjectobstructobviatepreventprescribesquenchtaboovetowardwithholdavertbarcheckcohibitcontaincurbdetainfendforestallhefthinderinhibitinterdictinterfereknock offoccludeprohibitrepressrestrainstintstopstrainward offclog upcurbingdiscontinuancefend forfend offinhibitedinhibitorinhibitorykerbobtrude uponwithholdingcurbeddisinhibitfendingfendsforhentinghalteringinhibitinginhibitivewithholdeninterceptingobstringeprelimitavailablecarpeffectillationvegetablefruitharvestknife bladeprofitprogenyresultrewardfructificationfruitionbruitsfrigsfrithfroisefroisesfromentyfrowstsfructifiedfruitedfruiteressfruitiestfruitingsfruitionsfruitivefruitsfrumentiesfrutexfruticesripesspruitfruit'yavowaldisplaydisclosurefindingmanifestationdeclarationindicationproclamationrevelationstatementtestimonyexpressageexpressedexpressiveexpressivenessexpressureexpressnessgrantvouchsafecome roundsidestepdigressavoidingavailabilityprocurementachievementadvantageattainmentproductrealisationacquirementachieveracquisitivenessobtainmentacervationachievingattainturepursuitsaccorporateacervalachievanceacquiescingacquietacquiryperquisitionprocurationbargaincompletedecidefinishpayponyrepaysettlewind upchicanabightcreekditchfirthbaycovesalinabreakcleavagefissurefracturegapgulfkerfslitcrackhiatusintersticenotchsplitstomacracklewarecracklingscragfastcragsmanscruffcrackjawcracknelcracknelscrackpotsscugsbroachdilatedisclose disentangle divulgeestuateboildissect divergeexposelooseopenpropaleseetheuncloseuncoverunfoldunlidunrolluntieunlooseunspellunwindunlatchesunpickingunpopeunpopingunropedisheduce effuseegest ejectemitevacuateprotrudebanishbring forthbring outdiscoverdismiss disposedispose ofdistilexceptexcludeexhibitexpelextractfind outhatchissueoustpublishremoveselectsellshowsubtracttake awaytake outthreshthrow outexcruciateexpellinggive ventejectingexpulseexsertingextractingextructbringfetchadducebring overbring underbuyincludeinductintroduceplantpurchasewin overbring tolanailanacanyonchasmfosse ditchingcauterizecauterizingfiringmarksearfiremaculatecavitymowpitsumptrapvatdendepressionfoveagravepitfallsinkholepitteredthe pitclenchconfute empaleendocclusionplugcapcloseintermitmureclosuringunsteplockdownturn offcastdumpejaculationdashflinghurlhurtlejerklaunchlobmewrejectscatterslamspillsquanderthrowthrowawaytiptosswarpwastedrowse offhurlinginfoldingpeltslingslingingthrash outpulpingsnaringsnarlingstrowingthrawthreapthreapingtrowingDisposed Offforgive desertforsakeuncouplevacatewalkwaytakeoffmove awayforgoomitspenddesistleaveabranchiateforsakinggiving uprelinquishingrenouncementabandoneeabdicatingaborddiscarnatedisentailforgoesforsakenlyforsakingsforsayforspendforspentforswearsforsworeforswornomittancerenouncesrenouncingabacinationabandonerabandumabannationabrenunciationabsinthiatediscardureforbatheforsakerforswornnesstristitiatecessationconstraintdissuasionestoppelfenceobstructionobstruentpullbackrailingclickdraginfringementinterferenceprohibitionstuntwallrokwithholdscelebratedisburselearnenactutterpay offpay outpayingchasehuntgamehuntingpreyquarryravinveneryvictimvictimisedvictimiservictimizedvictimizerenskiedhuncheshunchinghuntingshuntressespreyedpreyfulpronelyshikarshikarssufferersvictimisesvictimizesprevaricatingvictimatechaptercropdistinctiondivisionfieldclausepartitionsectionweatherclapper claweateatingfeedmushnutrimentpabulumviandbearconsumedinedinnerembezzleendurefarefeastfoodlunchmealmessmisappropriaterefectionrepastsupperswallowtifftommycaulinarycuisinesfoodismmealingmeal mouthedcommitchargeconsignconferfireawaygiveimpartallotassignawardendowhandinsertlendofferswamptaskdelegatedeliverdevolveentrustresigncondonedispenseremitforgivingforgivinglypardnerpardonerapayingforgingsimbursepardnerspardonerspardoningunpurseexculpatingexcurexoneratingbestowcommunicategive awayvestwreakconsequencesconclusionconsequenceoutcomeoutgrowthsequelaftermathcorollaryinferencerepercussionupshotenduefalchionoutguessresultantconcauseconcausesforthcomeocclusionsocclusivesoutfallsresultantsresultedresultingsequelsunflushesupcomeconsequentialnessresultancelicensepermitsanctionpermutepermutateempalementencumbranceguaranteehypothecationleemortgagemoundmunimentbarrierconcealment coveringdefenceexcuseinterventionmarrowpropprotectionscreenshadeshelterveilaarwindowrosencustomstaxdutyfreight impositionimpostlevyscattarifftaxationtollrevenuesdifferdisagreesecedewithdrawsepositiondiffuseoutpouremptyinfuseinpourlavepourpour outvallumgullymoattrenchtendrilstrencherstrenchingdilly dallyevadeprocrastinateshirkcast awayclean outdepleteunpackemptyingblankingemptionevacuatingvacatingvacuatevacuatingempasmemptemaleficiatemanumitridliberatingemancipatingdemitsee offsend offleisureholidayintermissionpermissionvacationvacationinghidageholidayedholidayingvackingoff dutydispossessevict outexpropriateevictingevictorevitateevitingexpellantoustersdisfellowshipoutshutexcreteexpurgategeldquashstrike offexcruciationdisjectemittingexpelleeexpunctingdeliquiatedisculpateexcalceationexclusionaryexclusionismexcoctionexcorticateexcorticationexscribedisusage relinquishrepudiatedivorcingdivorciverepudiationdivorceedivorcementdivulgementdivulgencedivingsdivorceesdivorcesdivulgesdivulsiondivulsionstalaqrebutrefuterepelspurndiscalceatedescramblerebiddingrejectingrejectamentarejectitiousrejectmentresubjectionrevictdisclaim frictionoppugnancyblockhindranceinterceptionoppositionresistanceresistlessresistantsrestiffrestiffnessdisentanglementemancipationautonomyindependenceindependencyunbindingenfreedomdrainage eductionegestionemanationemissionjuttyoutfalloutletexitexportextractionincomesaleearecstasyentrancementrapturegaitmarchdeparturedispatchgoingsmoothnesscoursingdepartercoursingsdepartersdepartingsdepartsdeparturesdepartableemanatejutoutbudspirtappearcome forthcome outemergegerminatepass awayrise sunnictatenictitatenickelizeflunkhobbleinhibitionfleetdecampdisappearvamosefarthersuperfluousextraoddotioseoverredundantsparesurplusunnecessarypallidlysparenessdivinatorspalladioussparefulfiatlibertymandatefluevaluebehoofbenefitimportanceinterestleverageuseusefulnessutilityvantageadvantageousnessbenefactbeneficbeneficebeneficiationgainfulnessavisementavisesavizesbenemptgainersgainsayswainageavailmentbeneficialnessbenemegainagerewegatewayvalvedooringressionportdoorcasedoorplatedoorwaydoorgadoorsteadgiftvailgratuitygreepremiumprizestakepriseprizewinninggrowthgerminationoriginalityguardsheildwarrantbindcollectdefendhelpparrypreserveprotectreprieverescueretrievesaveshieldshieldingadjectivinghoardsavingshurtimpairlacerateriflestabinjointidleabsolvedat easeburdenlesscontenteddevoiddischargeddisengagedfreeunoccupiedvacantignoreoverleapsnuboverlookshrug offjustprerogativeveracityveritywarrantablelotportionrightrighteousnesstruetruthrightorightosknuckleknuckle underpermissibilityclearanceauthorisationauthorizationpermissivenessdemissionperduesallowablenesspercepermisspermistionpermitteepermixtionlettingtimeoccasionopportunityrecoveryrestleisuredleisurelinessleisuresdepartmigraterepairresortshedshirksdeclinepostponerefuseslightnessindifferenceinsouciancenonchalancetemerityunvariednessnonusanceuncourtlinessunservicestirstirsinstallmake waysustainbidebrookcopeincurmatetoleratewithstandbear awaybear downbear down uponbear offbear onbear outbear upbear uponbring to bearforbearingtolewithstanderbearwardenduredsufferstoleratedtoleratingberainingincurtainwithstandingborne in uponnutateconvincingnessgive upreclimbburyrecklessnessrelievingaccomplishcarry outfulfilperformpractiserenderingreceivedreceivershiprecensesrecipiencyreceivednessaddlearidfruitlessill growninfecundinfertileinhospitablenakedsterileuncultivablebungedbunglersbarrenlybarren ofto be attracteddodgepalterslink awaystand offshamecut offdeletedesalinisationdeletionsdeleterydelineatorydeliveryfurloughvaledictionwildernessplaindesertificationdesertiondesertslut desertsyrian desertdesertersdesertionsdissertsdesertnessdesertricedesertrixdetachmentinjunctionleavinglicencerelinquishmentchutediscalcedabatementsabattiseschuteschutsdiscasingdiscordingdiscounteddiscountsexegesesexemptedexemptingexemptionsexemptsexeuntlaybacklaybackinglaybackslibationsomissionsquitchesrebatedrebatementrebatesrebatingrebatoesrebidrebiterebitesrebitingrecessingremountswaiverswaiveswaivingabjectednessdiscagediscalceationdiscountablediscountingedaciousgluttongourmandpassvocaliseenfeoffremisearsenatesurrebuttalsurrebutterarseniatesurrendryflearsurrenderingexemptoblivionproductiongemmaimptendronlosekick outlet goloosenrelaxrebuff
Idioms with the word chhorna - چھوڑنا in it
Idioms related to the meaning of chhorna - چھوڑنا
What are the meanings of chhorna - چھوڑنا in English?
Meanings of the word chhorna - چھوڑنا in English are abandon, abdicate, absolve, abstain, acquisition, avoid, discharge, disuse, divorce, ditch, emit, emancipate, eschew, evict, evacuate, forgive, forgo, leave, let, liberate, omit, pardon, quit, shoot, spare, vent, waive, yield, desert, forsake, give up, let go, release, relinquish, render, resign, set aside, abjoint, disendow, forslack, quiting, quitting and discede. To understand how would you translate the word chhorna - چھوڑنا in English, you can take help from words closely related to chhorna - چھوڑنا or it’s English translations. Some of these words can also be considered chhorna - چھوڑنا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word chhorna - چھوڑنا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use chhorna - چھوڑنا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say chhorna - چھوڑنا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of chhorna - چھوڑنا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by چھوڑنا?
Meanings of چھوڑنا are abandon, abdicate, absolve, abstain, acquisition, avoid, discharge, disuse, divorce, ditch, emit, emancipate, eschew, evict, evacuate, forgive, forgo, leave, let, liberate, omit, pardon, quit, shoot, spare, vent, waive, yield, desert, forsake, give up, let go, release, relinquish, render, resign, set aside, abjoint, disendow, forslack, quiting, quitting and discede
Whats the definition of چھوڑنا?
Definition of the چھوڑنا are
- a feeling of extreme emotional intensity
- give up with the intent of never claiming again
- forsake, leave behind
- leave someone who needs or counts on you; leave in the lurch
- leave behind empty; move out of
- the trait of lacking restraint or control; reckless freedom from inhibition or worry
- stop maintaining or insisting on; of ideas or claims
- give up, such as power, as of monarchs and emperors, or duties and obligations
- grant remission of a sin to
- refrain from voting
- choose not to consume
- an ability that has been acquired by training
- the act of contracting or assuming or acquiring possession of something
- something acquired
- the cognitive process of acquiring skill or knowledge
- prevent the occurrence of; prevent from happening
- refrain from doing something
- stay clear from; keep away from; keep out of the way of someone or something
- refrain from certain foods or beverages
- declare invalid
- pronounce not guilty of criminal charges
- complete or carry out
- the act of discharging a gun
- the act of venting
- the sudden giving off of energy
- any of several bodily processes by which substances go out of the body
- a substance that is emitted or released
- a formal written statement of relinquishment
- the termination of someone's employment (leaving them free to depart)
- release from military service
- pour forth or release
- remove the charge from
- become empty or void of its content
- cause to go off
- go off or discharge
- eliminate (a substance)
- remove (cargo, people, etc.) from and leave
- the state of something that has been unused and neglected
- part; cease or break association with
- the legal dissolution of a marriage
- get a divorce; formally terminate a marriage
- throw away
- a long narrow excavation in the earth
- any small natural waterway
- forsake
- crash or crash-land
- make an emergency landing on water
- sever all ties with, usually unceremoniously or irresponsibly
- cut a trench in, as for drainage
- expel (gases or odors)
- give off, send forth, or discharge; as of light, heat, or radiation, vapor, etc.
- express audibly; utter sounds (not necessarily words)
- give equal rights to; of women and minorities
- free from slavery or servitude
- expel from one's property or force to move out by a legal process
- expel or eject without recourse to legal process
- excrete or discharge from the body
- empty completely
- move out of an unsafe location into safety
- move people from their homes or country
- create a vacuum in (a bulb, flask, reaction vessel)
- absolve from payment
- stop blaming or grant forgiveness
- do without or cease to hold or adhere to
- lose (s.th.) or lose the right to (s.th.) by some error, offense, or crime
- permission to do something
- the act of departing politely
- leave behind unintentionally
- the period of time during which you are absent from work or duty
- remove oneself from an association with or participation in
- act or be so as to become in a specified state
- have left or have as a remainder
- be survived by after one's death
- go and leave behind, either intentionally or by neglect or forgetfulness
- leave unchanged or undisturbed or refrain from taking
- go away from a place
- put into the care or protection of someone
- leave or give by will after one's death
- move out of or depart from
- transmit (knowledge or skills)
- produce as a result or residue
- cause to move; cause to be in a certain position or condition
- grant use or occupation of under a term of contract
- a serve that strikes the net before falling into the receiver's court; the ball must be served again
- leave unchanged
- actively cause something to happen
- a brutal terrorist group active in Kashmir; fights against India with the goal of restoring Islamic rule of India
- give equal rights to; of women and minorities
- grant freedom to
- release (gas or energy) as a result of a chemical reaction or physical decomposition
- leave undone or leave out
- prevent from being included or considered or accepted
- a warrant granting release from punishment for an offense
- the formal act of liberating someone
- grant a pardon to
- accept an excuse for
- go away or leave
- put an end to a state or an activity
- give up or retire from a position
- turn away from; give up
- give up in the face of defeat of lacking hope; admit defeat
- run or move very quickly or hastily
- spend frivolously and unwisely
- make a film or photograph of something
- produce buds, branches, or germinate
- record on photographic film
- kill by firing a missile
- hit with a missile from a weapon
- the act of shooting at targets
- a new branch
- send forth suddenly, intensely, swiftly
- cause a sharp and sudden pain in
- emit (as light, flame, or fumes) suddenly and forcefully
- measure the altitude of by using a sextant
- utter fast and forcefully
- score
- fire a shot
- throw dice, as in a crap game
- variegate by interweaving weft threads of different colors
- throw or propel in a specific direction or towards a specific objective
- give an injection to
- force or drive (a fluid or gas) into by piercing
- a score in tenpins; knocking down all ten after rolling two balls
- an extra car wheel and tire for a four-wheel vehicle
- an extra component of a machine or other apparatus
- give up what is not strictly needed
- save or relieve from an experience or action
- use frugally or carefully
- thin and fit
- kept in reserve especially for emergency use
- more than is needed, desired, or required
- lacking embellishment or ornamentation
- lacking in magnitude or quantity
- expose to cool or cold air so as to cool or freshen
- external opening of urinary or genital system of a lower vertebrate
- a hole for the escape of gas or air
- a slit in a garment (as in the back seam of a jacket)
- a fissure in the earth's crust (or in the surface of some other planet) through which molten lava and gases erupt
- give expression or utterance to
- activity that frees or expresses creative energy or emotion
- do without or cease to hold or adhere to
- lose (s.th.) or lose the right to (s.th.) by some error, offense, or crime
- be the cause or source of
- an amount of a product
- give or supply
- be flexible under stress of physical force
- move in order to make room for someone for something
- production of a certain amount
- the quantity of something (as a commodity) that is created (usually within a given period of time)
- bring in
- be fatally overwhelmed
- consent reluctantly
- give in, as to influence or pressure
- cease opposition; stop fighting
- cause to happen or be responsible for
- the income or profit arising from such transactions as the sale of land or other property
- end resistance, as under pressure or force
- leave someone who needs or counts on you; leave in the lurch
- arid land with little or no vegetation
- leave behind
- desert (a cause, a country or an army), often in order to join the opposing cause, country, or army
- (usually plural) a person's deservingness of or entitlement to reward or punishment
- leave someone who needs or counts on you; leave in the lurch
- give up with the intent of never claiming again
- put an end to a state or an activity
- stop consuming
- give up in the face of defeat of lacking hope; admit defeat
- give up what is not strictly needed
- allow the other (baseball) team to score
- relinquish possession or control over
- give up or agree to forgo to the power or possession of another
- stop maintaining or insisting on; of ideas or claims
- lose (s.th.) or lose the right to (s.th.) by some error, offense, or crime
- leave (a job, post, or position) voluntarily
- be relaxed
- release, as from one's grip
- a legal document evidencing the discharge of a debt or obligation
- a formal written statement of relinquishment
- the termination of someone's employment (leaving them free to depart)
- the act of liberating someone or something
- generate and separate from cells or bodily fluids
- the act of allowing a fluid to escape
- prepare and issue for public distribution or sale
- a device that when pressed will release part of a mechanism
- euphemistic expressions for death
- eliminate (a substance)
- release (gas or energy) as a result of a chemical reaction or physical decomposition
- make (information) available for publication
- an announcement distributed to members of the press in order to supplement or replace an oral presentation
- (music) the act or manner of terminating a musical phrase or tone
- activity that frees or expresses creative energy or emotion
- merchandise issued for sale or public showing (especially a record or film)
- a process that liberates or discharges something
- let (something) fall or spill from a container
- release, as from one's grip
- do without or cease to hold or adhere to
- turn away from; give up
- release, as from one's grip
- give or supply
- bestow
- show in, or as in, a picture
- make over as a return
- restate (words) from one language into another language
- pass down
- to surrender someone or something to another
- give something useful or necessary to
- give an interpretation or rendition of
- a substance similar to stucco but exclusively applied to masonry walls
- cause to become
- melt (fat or lard) in order to separate out impurities
- coat with plastic or cement
- give back
- give up or retire from a position
- accept as inevitable
- leave (a job, post, or position) voluntarily
- reserved in advance
- give or assign a resource to a particular person or cause
- make inoperative or stop
- annul (a legal decision)
- ایسا نالہ جو سیم کا پانی سُونتنے کے لیے کھودا جاۓ
- بذریعہ حکم عدالت بے دخل کرنا
- پابَندی يا قيد سے آزاد کَرنا
- جو عورت قانونی حفاظت سے باہر ہو
What is the synonym of چھوڑنا?
Synonym of word چھوڑنا are بے پروائی, لا ابالی پن, مست مولا پن, باز آنا, چھوڑنا, ڈال دینا, خاک ڈالنا, ترک کرنا, بے پرواہی, لاابالی پن
What are the idioms with the word چھوڑنا?
Here are the idioms with the word چھوڑنا in them.
- Let go
- Walk off
- Let go
- Let not poverty part good company
- Put to ransom
What are the idioms related to چھوڑنا?
Here are the idioms that are related to the word چھوڑنا.
- Avoid evil and it will avoid thee
- Spare to speak and spare the speed
- Abandon oneself
- Give vent to
- It may be the lot of a brave man to fall he cannot yield