sakht - سخت meanings in English
sakht - سخت meanings in English are foughty, strictured, stridulant, stridulous, strifeful, stripeless, strumatic, strumous, struthious, strutted, tartareous, tatous, tattier, tautened, tightened, tightens, tighter, toilful, stricter, strich, streperous, fructuous, harrowed, harshened, hushy, mordent, severer, sterner, sternitic, sternward, stied, stiffened, stiffer, stiffish, stillest, stiver, stoor, stratous, torminous, torrefied, roboreous, slent, sordiferous, stibious, strigous, strude, stupeous, sturk, swough, tartarous, tentiginous, teretous, tergeminous, terreous, tonous, tureenful, ustorious, rigidulous, quercite, piligerous, toughener, tougheners, toughening, tougher, toughish, touzle, touzled, touzling, trothful, tushy, verrucous, constringent, dureful, efferous, enervous, harborous, liefsome, wieldsome, fierier, aggravated, exacting, extreme, firm, flinty, grim, hard, harsh, heathenish, heavy, high handed, horny, inclement, indurate, inelastic, inexorable, inflexible, intense, cruel, callous, stony, arduous, consolidated, diamond, difficult, drastic, egregious, impenitent, impetuous, morose, obdurate, operose, oppressive, outrageous, raw, strong, stiff, stringent, ironclad, laborious, raucous, ribless, rigout, scrumptious, scrumpy, sorbent, sternutative, sternutatory, stiffener, stratified, stumpy, toilsome, toughened, touter, wrothful, durst, fiercer, lacrimal, hardening, argentous, loud, nipping, rigid, rigourous, severe, strengthened, strict, sturdy, taut, tough, trying, unbending, uncompromising, unmerciful, vehement, violent, wooden, fiercest sakht - سخت in English. More meanings of sakht - سخت, it's definitions, example sentences, related words, idioms and quotations.
foughty strictured stridulant stridulous strifeful stripeless strumatic strumous struthious strutted tartareous tatous tattier tautened tightened tightens tighter toilful stricter strich streperous fructuous harrowed harshened hushy mordent severer sterner sternitic sternward stied stiffened stiffer stiffish stillest stiver stoor stratous torminous torrefied roboreous slent sordiferous stibious strigous strude stupeous sturk swough tartarous tentiginous teretous tergeminous terreous tonous tureenful ustorious rigidulous quercite piligerous toughener tougheners toughening tougher toughish touzle touzled touzling trothful tushy verrucous constringent dureful efferous enervous harborous liefsome wieldsome fierier aggravated exacting extreme firm flinty grim hard harsh heathenish heavy high handed horny inclement indurate inelastic inexorable inflexible intense cruel callous stony arduous consolidated diamond difficult drastic egregious impenitent impetuous morose obdurate operose oppressive outrageous raw strong stiff stringent ironclad laborious raucous ribless rigout scrumptious scrumpy sorbent sternutative sternutatory stiffener stratified stumpy toilsome toughened touter wrothful durst fiercer lacrimal hardening argentous loud nipping rigid rigourous severe strengthened strict sturdy taut tough trying unbending uncompromising unmerciful vehement violent wooden fiercest
sakht - سخت Definitions
Please find 245 English and 3 Urdu definitions related to the word sakht - سخت.
- (adjective satellite) : made more severe or intense especially in law
- (adjective satellite) : incited, especially deliberately, to anger
- (adjective satellite) : difficult to accomplish; demanding considerable mental effort and skill
- (adjective satellite) : taxing to the utmost; testing powers of endurance
- (adjective satellite) : characterized by effort to the point of exhaustion; especially physical effort
- (adjective satellite) : forming a solid mass
- (adjective satellite) : joined together into a whole
- (adjective satellite) : (of persons or their actions) able or disposed to inflict pain or suffering
- (noun) : a transparent piece of diamond that has been cut and polished and is valued as a precious gem
- (noun) : very hard native crystalline carbon valued as a gem
- (noun) : the area of a baseball field that is enclosed by 3 bases and home plate
- (noun) : the baseball playing field
- (noun) : a playing card in the minor suit that has one or more red rhombuses on it
- (noun) : a parallelogram with four equal sides; an oblique-angled equilateral parallelogram
- (adjective) : not easy; requiring great physical or mental effort to accomplish or comprehend or endure
- (adjective) : hard to control
- (adjective satellite) : forceful and extreme and rigorous
- (adjective satellite) : conspicuously and outrageously bad or reprehensible
- (adjective satellite) : securely fixed in place
- (verb) : make taut or tauter
- (verb) : become taut or tauter
- (adjective satellite) : marked by firm determination or resolution; not shakable
- (adjective satellite) : not subject to revision or change
- (adjective satellite) : not liable to fluctuate or especially to fall
- (adjective satellite) : (of especially a person's physical features) not shaking or trembling
- (adjective satellite) : strong and sure
- (adjective satellite) : unwavering in devotion to friend or vow or cause
- (adjective satellite) : not soft or yielding to pressure
- (adverb) : with resolute determination
- (noun) : the members of a business organization that owns or operates one or more establishments
- (adjective satellite) : possessing the tone and resiliency of healthy tissue
- (adjective satellite) : filled with melancholy and despondency
- (adjective satellite) : having horns or hornlike projections
- (adjective satellite) : feeling great sexual desire
- (adjective satellite) : made of horn (or of a substance resembling horn)
- (adjective) : not penitent or remorseful
- (adjective satellite) : impervious to moral persuasion
- (adjective satellite) : marked by violent force
- (adjective satellite) : characterized by undue haste and lack of thought or deliberation
- (adjective satellite) : characterized by effort to the point of exhaustion; especially physical effort
- (adjective satellite) : marked by unjust severity or arbitrary behavior
- (adjective satellite) : weighing heavily on the senses or spirit
- (adjective satellite) : grossly offensive to decency or morality; causing horror
- (adjective satellite) : greatly exceeding bounds of reason or moderation
- (adjective satellite) : unpleasantly cold and damp
- (adjective satellite) : not processed or subjected to analysis
- (adjective satellite) : devoid of elaboration or diminution or concealment; bare and pure
- (noun) : informal terms for nakedness
- (adjective satellite) : having the surface exposed and painful
- (adjective satellite) : untempered and unrefined
- (adjective satellite) : not processed or refined
- (adjective) : not treated with heat to prepare it for eating
- (adjective satellite) : brutally unfair or harsh
- (adjective satellite) : (used informally) completely unclothed
- (adjective satellite) : used of wood and furniture
- (adjective satellite) : (used especially of commodities) being unprocessed or manufactured using only simple or minimal processes
- (adjective satellite) : incapable of compromise or flexibility
- (adjective satellite) : incapable of or resistant to bending
- (adjective) : designating an airship or dirigible having a form maintained by a stiff unyielding frame or structure
- (adjective satellite) : incapable of adapting or changing to meet circumstances
- (adjective satellite) : fixed and unmoving
- (adjective satellite) : very strong or vigorous
- (adjective satellite) : intensely or extremely bad or unpleasant in degree or quality
- (adjective satellite) : very bad in degree or extent
- (adjective satellite) : severely simple
- (adjective satellite) : incapable of compromise or flexibility
- (adjective satellite) : rigidly accurate; allowing no deviation from a standard
- (adjective satellite) : (of rules) stringently enforced
- (adjective satellite) : severe and unremitting in making demands
- (adjective) : characterized by strictness, severity, or restraint
- (adjective satellite) : strong and sure
- (adjective satellite) : not faint or feeble
- (adjective satellite) : of verbs not having standard (or regular) inflection
- (adjective) : having strength or power greater than average or expected
- (adjective satellite) : freshly made or left
- (adjective) : having a strong physiological or chemical effect
- (adjective satellite) : having or wielding force or authority
- (adjective satellite) : of good quality and condition; solidly built
- (adjective satellite) : being distilled rather than fermented; having a high alcoholic content
- (adjective satellite) : immune to attack; incapable of being tampered with
- (adjective satellite) : having rugged physical strength; inured to fatigue or hardships
- (adjective satellite) : substantially made or constructed
- (adjective) : not making concessions
- (adverb) : extremely
- (adjective satellite) : rigidly formal
- (noun) : the dead body of a human being
- (adjective satellite) : marked by firm determination or resolution; not shakable
- (adjective satellite) : incapable of or resistant to bending
- (adjective) : having a strong physiological or chemical effect
- (noun) : an ordinary man
- (adjective satellite) : not moving or operating freely
- (adjective satellite) : powerful
- (adverb) : in a stiff manner
- (adjective satellite) : demanding strict attention to rules and procedures
- (adjective satellite) : abounding in rocks or stones
- (adjective satellite) : hard as granite
- (adjective satellite) : pulled or drawn tight
- (adjective satellite) : marked by extreme intensity of emotions or convictions; inclined to react violently; fervid
- (adjective satellite) : characterized by great force or energy
- (adjective satellite) : characterized by violence or bloodshed
- (adjective satellite) : marked by extreme intensity of emotions or convictions; inclined to react violently; fervid
- (adjective satellite) : (of colors or sounds) intensely vivid or loud
- (adjective satellite) : effected by force or injury rather than natural causes
- (adjective) : acting with or marked by or resulting from great force or energy or emotional intensity
- (adjective satellite) : made or consisting of (entirely or in part) or employing wood
- (adjective satellite) : lacking ease or grace
- (adjective) : relating to compounds in which silver is univalent
- (verb) : make insensitive or callous; deaden feelings or morals
- (adjective satellite) : emotionally hardened
- (adjective satellite) : having calluses; having skin made tough and thick through wear
- (adjective) : having complicated nutritional requirements; especially growing only in special artificial cultures
- (adjective satellite) : severe and unremitting in making demands
- (adjective satellite) : requiring precise accuracy
- (noun) : the furthest or highest degree of something
- (noun) : the point located farthest from the middle of something
- (adjective satellite) : most distant in any direction
- (adjective satellite) : of the greatest possible degree or extent or intensity
- (adjective satellite) : beyond a norm in views or actions
- (adjective satellite) : far beyond a norm in quantity or amount or degree; to an utmost degree
- (adjective) : containing flint
- (adjective) : not easy; requiring great physical or mental effort to accomplish or comprehend or endure
- (adverb) : with firmness
- (adjective satellite) : very strong or vigorous
- (adverb) : causing great damage or hardship
- (adjective) : (of light) transmitted directly from a pointed light source
- (adjective satellite) : dried out
- (adjective satellite) : unfortunate or hard to bear
- (adjective) : resisting weight or pressure
- (adjective) : dispassionate
- (adjective satellite) : given to excessive indulgence of bodily appetites especially for intoxicating liquors
- (adjective) : produced without vibration of the vocal cords
- (adverb) : with effort or force or vigor
- (adverb) : slowly and with difficulty
- (adverb) : earnestly or intently
- (adverb) : with pain or distress or bitterness
- (adverb) : very near or close in space or time
- (adverb) : into a solid condition
- (adverb) : indulging excessively
- (adjective satellite) : characterized by effort to the point of exhaustion; especially physical effort
- (adjective) : (of speech sounds); produced with the back of the tongue raised toward or touching the velum
- (adjective satellite) : being distilled rather than fermented; having a high alcoholic content
- (adverb) : to the full extent possible; all the way
- (noun) : the process of becoming hard or solid by cooling or drying or crystallization
- (noun) : the act of making something harder (firmer or tighter or more compact)
- (noun) : abnormal hardening or thickening of tissue
- (adjective satellite) : sharply disagreeable; rigorous
- (adjective) : of textures that are rough to the touch or substances consisting of relatively large particles
- (adjective satellite) : unkind or cruel or uncivil
- (adjective satellite) : unpleasantly stern
- (adjective satellite) : unpleasantly rough or jarring to the senses
- (adjective satellite) : (used of soil) compact and fine-grained
- (adjective satellite) : in an advanced stage of pregnancy
- (adjective satellite) : permitting little if any light to pass through because of denseness of matter
- (adjective satellite) : usually describes a large person who is fat but has a large frame to carry it
- (adjective satellite) : (of sleep) deep and complete
- (adjective satellite) : prodigious
- (adjective satellite) : given to excessive indulgence of bodily appetites especially for intoxicating liquors
- (adverb) : slowly as if burdened by much weight
- (noun) : a serious (or tragic) role in a play
- (noun) : an actor who plays villainous roles
- (adjective satellite) : lacking lightness or liveliness
- (adjective satellite) : requiring or showing effort
- (adjective satellite) : sharply inclined
- (adjective satellite) : dense or inadequately leavened and hence likely to cause distress in the alimentary canal
- (adjective) : of comparatively great physical weight or density
- (adjective) : unusually great in degree or quantity or number
- (adjective) : of great intensity or power or force
- (adjective satellite) : slow and laborious because of weight
- (adjective satellite) : full and loud and deep
- (adjective satellite) : made of fabric having considerable thickness
- (adjective satellite) : of relatively large extent and density
- (adjective satellite) : (of an actor or role) being or playing the villain
- (adjective satellite) : characterized by effort to the point of exhaustion; especially physical effort
- (adjective satellite) : full of; bearing great weight
- (adjective satellite) : large and powerful; especially designed for heavy loads or rough work
- (adjective) : marked by great psychological weight; weighted down especially with sadness or troubles or weariness
- (adjective) : (physics, chemistry) being or containing an isotope with greater than average atomic mass or weight
- (adjective) : of the military or industry; using (or being) the heaviest and most powerful armaments or weapons or equipment
- (adjective satellite) : given to haughty disregard of others
- (adjective) : (of weather or climate) severe
- (adjective) : used of persons or behavior; showing no clemency or mercy
- (adjective satellite) : emotionally hardened
- (verb) : become hard or harder
- (verb) : make hard or harder
- (verb) : become fixed or established
- (verb) : cause to accept or become hardened to; habituate
- (adjective) : not elastic
- (adjective satellite) : impervious to pleas, persuasion, requests, reason
- (adjective satellite) : incapable of adapting or changing to meet circumstances
- (adjective) : resistant to being bent
- (adjective) : incapable of change
- (adjective) : not making concessions
- (adjective satellite) : (of color) having the highest saturation
- (adjective) : possessing or displaying a distinctive feature to a heightened degree
- (adjective satellite) : extremely sharp or severe
- (adjective satellite) : inflexibly entrenched and unchangeable
- (noun) : a wooden warship of the 19th century that is plated with iron or steel armor
- (adjective satellite) : sheathed in iron plates for protection
- (adjective satellite) : characterized by effort to the point of exhaustion; especially physical effort
- (adjective) : relating to or located near the organ that produces tears
- (adjective) : of or relating to tears
- (adverb) : with relatively high volume
- (adjective) : characterized by or producing sound of great volume or intensity
- (adjective) : (used chiefly as a direction or description in music) loud; with force
- (adjective satellite) : capable of wounding
- (adjective satellite) : pleasantly cold and invigorating
- (adjective satellite) : disturbing the public peace; loud and rough
- (adjective satellite) : unpleasantly loud and harsh
- (adjective) : having no ribs or no visible ribs
- (noun) : a person's costume (especially if bizarre)
- (adjective satellite) : extremely pleasing to the sense of taste
- (noun) : strong cider (as made in western England)
- (noun) : a material that sorbs another substance; i.e. that has the capacity or tendency to take it up by either absorption or adsorption
- (adjective satellite) : causing sneezing
- (noun) : a chemical substance that causes sneezing and coughing and crying
- (adjective satellite) : causing sneezing
- (adjective) : tending to cause sneezing
- (noun) : material used for stiffening something
- (adjective) : deposited or arranged in horizontal layers
- (adjective satellite) : (used of society) socially hierarchical
- (adjective satellite) : arranged in a sequence of grades or ranks
- (adjective satellite) : given added strength or support
- (adjective satellite) : short and thick; as e.g. having short legs and heavy musculature
- (adjective satellite) : characterized by effort to the point of exhaustion; especially physical effort
- (noun) : a cruel and brutal fellow
- (noun) : an aggressive and violent young criminal
- (adjective satellite) : substantially made or constructed
- (adjective satellite) : unfortunate or hard to bear
- (noun) : someone who learned to fight in the streets rather than being formally trained in the sport of boxing
- (adjective) : resistant to cutting or chewing
- (adjective) : physically toughened
- (adjective) : not given to gentleness or sentimentality
- (adjective satellite) : violent and lawless
- (adjective satellite) : feeling physical discomfort or pain ( tough' is occasionally used colloquially for bad')
- (adjective satellite) : making great mental demands; hard to comprehend or solve or believe
- (adjective satellite) : very difficult; severely testing stamina or resolution
- (adjective) : made hard or flexible or resilient especially by heat treatment
- (adjective) : physically toughened
- (noun) : someone who advertises for customers in an especially brazen way
- (adjective satellite) : extremely irritating to the nerves
- (adjective satellite) : hard to endure
- (adjective satellite) : incapable of adapting or changing to meet circumstances
- (adjective) : not making concessions
- (adjective) : having or showing no mercy
- (adjective satellite) : vehemently incensed and condemnatory
- قُوت اور تشدد سے کام لیتے ہوۓ
- مُحتاط طور پر حدود کے اندر اندر
- شدید جِسمانی قُوَّت سے مُتعلِّق
More words related to the meanings of sakht - سخت
More words from English related to sakht - سخت
View an extensive list of words below that are related to the meanings of the word sakht - سخت meanings in English in English.
able bodiedstrongstoutstalwartburlycanthaleheftynot illtoughwell builtwell fedmightyvigorousabortiveimperfectraretimorousalloyedamateuramateurishapproximatecrudedefectivedeficientficklefluctuatingfrailgreenhalf rawimmatureinconsistentinconstantindigestedinefficaciousinexperiencedirresoluteloosenewbienon permanentrawroughslipperytimidunauthenticatedunbakeduncookedunpavedunreliableunripe ... unstampedunsteadyvagueweakyieldingkacchakacchaskutchaabstrusearduousdifficultimpassableoperosehardonerousseveretryingembarrassmentirksomeobstaclepalacepinchpuzzlingthornyabstractcomplicateddifficultydilemmahardshiphot waterintricacyintricatenarrowoccultpainfulperplexityproblemsteeptangletenacioustortuoustroubleuphillwearifulwearisomedifficilehardertuskydifficilitatedifficultateabrasiveablestlustypeppyablelivelystrenuouszippyefficaciousenergeticovermatchcogentforcefulpotentsturdywallopingpotentisedpotentsquaveactactioncallingjoblustmakingmanufactureploytendvalueworkbusinessdesigndesireembroideryemploymentengagementerrand functionintentionlabourmetierobjectoccupationpurporttaskundertakinguseworkmanshipchoreskamcom werkacerbicgingerhastyvehementafraidawfuldiredreadfulfearsomegrimhorrifichorriblealarmingdangerousfearfulfrightfulghastlygrisyhair raisinghorrendousintimidatingluridminatorymonstrousterrifyingdirefuldreadnaughtenfant terriblehorrifyinghorror struckscarecrowishscareyscreakyawhapeawhapingawmousawniercroupousdreadingdreadlydrouthiestfrightinggruesomesthorrifiesscarierscathefulscoriousscusingterrifierterrorfulveneficastriferousdernfuldreadablefriblehorrisonousterrificalaggravatedbulkyearthy grandgrievousimportantlethargiclumpishmassivemomentousoppressivetedioustrampburdensomecumbersomeheavyhugehulkylandslidelifelessloudstodgyweightyheavyheartedheavierheaviesheftilyoutweepingwavierheaperheavisomeheavy headedhevedarchbigbroadcardinalcrackegregiousenormousforemostgreatgrosshugeousimmenseleadingmainmajormicklepalmaryprincipalsignalsizablesuperiorvastelderextensivegiantlargeoldsterportlypresbyterultrawidebiggerbiggishoverseriousoversizeoversizedbiggedbiggingoversizeslargetbayonetgravemarble breastedseriousbayonetingbayonetsbayonettedfeloniesfelonousfelonryfelstonegravellinggriminggrimmercrucigerousgripefulagogdiligententhusiastenthusiastsobservantvivaciouswarm heartedzealousardentdashingearnest intensezealotactivisticaggressivegriperimperiousoppressorsterndespottyrantjabersjamberoppressorstyrannisedtyrocinybastardcruelapplicableappositejustifiableopportunepunctillioustautvalidaccurateappropriateconscionablecorrectfitgradelyindubitableintactintegraljustokpermissiblepreciseprimproperrightsafesoundsuitabletruewellwell balancedacculturatecorrectedcorrigibleverificatoryarrectauratefixablearrectaryftictionverificativeapproximativeimmediaeimminentnextnighstrictadjacentakinalmostapproachingapproximatelycontiguousat handto handhandyimmediatenearclosemouthedclosernearernearsideproximalafearingclosersnearednearingnearsnighnessupclosevicingapproacherapproximatedapproximatingclose barrednearcticnearhandneatifyproximebyarbitrarybrutalbutcherferociousmurderousbloodthirstybullycallousfell heartlesshectorimmaneiniquitouskindlessnighthawkremorselesstormentortyrannicunjustunmercifulunsparingviperwantonwickedtyrannityrannidtyrannidaetyrannistyrannizedtyrantstyringtyrantyrannishdistress ticklishinconvenientintractablelaboriouswell earnedstifflivelihoodemployablejobsworthawe inspiringdismal dreargiganticgrislyterribleterriblenessformidablegruesomehideoushorridawfullygreatlygrosslyhugelymostovermuchparlousquiteseverelythoroughvastlyveryaboundingamplecopiousendexceedinglyexcessiveextremelyextremityhyperintenselylastlimitrifeawrycross grainedobliquelyskewbackbonedbutchflat footedfudiciarylingyoakystaunchblowzybrawnyconsolidateddurablefastfirmindissolublelastingresoluterobustrootedstabilesteadfaststeadyunbendingunmovedbolsteredfirmerstrongerstrongishstrongylstrongylestrongylsstrontiansturtingstrengerstrondstronghandstrongylidstruntianbadassbackwardterminalcloseextremefinal finistag endutmostendonucleasefuckheadaftmostculminantculminatedculminatesendlongferforthlybanglebraceletdiamondimmalleablestringentadamantankletflintyhardenedhardyharshhoarseimplacableinauspiciousinexorableinflexibleinveterateobduraterefractoryrigidrigourousrudeunluckyunyieldingviolentyeomanlybraceletsbrantlesbarbarianferinetruculentwildanimalbarbarousbeastcrazyfierceheathenishinhumansavageunciviliseduncultivatedunculturedyahoobarbarianssavagedsavagedomsavagesbarbigerousbarbariousbigotbigotedheadstrongintransigentobstinatepertinaciousstubbornuncompromisingbindingconfidentemphaticsureblasphemousdisbelieverdissident gentilegiaourimpiousirreligionistmiscreantmoorscepticgodlessheatheninfidelmistressnon believerpagansweetheartunbelieverdisbelievingkafirinfidelsunbelievedpagandompaganicpaganitypaganlyblunderheadgabygreenhornstupidasinineclotdoltdonkeydrabdullfoolgandergawkishgoofgoofygoongoophalf wittedidiotimprudentinaneinsensatejackassmindlessmoonymulishmuttnincompoopoafoafishwitlesswoodenzanybelatedlyblollydaftnessevasivelyunlovelybefooledbelaboredbractlessidiolectsmanelesspraiselesswitelessbebloodydisrulydisslanderousexorhizousexortivefool bornfool happyfool hastyfool largefool largessefoolhardihoodfoolhardilyfraudlessfrownymanlesslypretenselessbrilliantdifferenteminenthonouredpre eminentstatesmenacechosencrackingdiagnosticdiscriminatedistinct distinguishedexaltedloftymarkednotableobservableoutstandingprominentprosilientsalientdifferentiateddenominativelyindistinguishedsupereminentbrusqueimpolitebluffclownishunamiableunciviluncourteousuprootalferalrusticuncouthuntamedwildingjanglyjunglyjunglijunglierwildestwildishjangleryoutrageousrampantheinousmacabrebarbaricbrazencheekyimpertinenceimpudentinsolentsaucyshamelessunabashedunblushingbremediluvial slanderousgushinggustygustfulinclementstormytempestuouswindystorminessstorthingsurquedrousstormablebull headedcontumaciousimportuneobstetricopinionedpiggishself willedwaywarddoggeddouropinionatedreluctantstubbystumerstumersspeedydesultoryfoolhardyheadlongheadyimpetuousprecipitatorprecipitousrashcut throatruffianexecutionerhangmanheadsmanmercilesslivingpowerfulpuissantstrongmanwiryall powerfulblightybowerypotfulpowerfullymightfulmightierpotentatespottiestpowwowsstrongmenhighty tightypowerablesleightystrengthnercalculousgravellystonygrittyhillyrockycapricediabolicalfiercelyoppressivelytyrannousdraconianhigh handedbrutalistscruellercruellestcruentousoverrighteoustyrannicidalcarefulconsideratediscreetcautionaryimperativestressfulurgentclottedcoherentmotheryembeddedice boundinsistentfrozenglacialhard setfreeze offfreeze outfreezingfrowzledfurzedefrozenfezzedfoziestfozinessfreezablefreezesfriskfulfriskiestfrisurefrizzedfrozecoagulatecongealcoherefastenmotherpitchquadratevegetateconsolidatefreezegrowhardeninduratejellsettake rootclottyclotburclottingclompingclotterclotteredclotteringcloturingcoagulatingcompactconcretefraught impermeableimporousbrainysolidtersetightsolidarysolidestsolidschinnedsolidunguloustouzesolemnconfiscatorcautiousdisciplinarianestablishedgovernorpossessorprudentpunctualregulatorrestrainerretentivesatrapdisobedientimpenitentmuzzydisloyalerrant indocileindomitableinexpungibleinsubordinateinsurgentjadishobstreperousrebelliousrestiveuncontrollableunmanageablerebelliouslycriantrevulsivehirtellousenigmaticmazyentangledimplicitinextricableinvoluteinvolvedlabyrinthinecomplexifiercomplexifycomplexlycomplinescrewysuffrutexcastigatedcomplexedcomplexingcomplexuscomplicantdilativedistensivedistichousimpleximplexuouspatchablepatheticalperchedpetrificpleuchsscrewiestscuzzystilettoedtituledachroouscomplexionalcomplexionallycomplexionarycomplexionedcomplicatelycomplicatingincicurableinflexiveintricableconsistentcertifiedconfirmedenduringfixedincorruptingrainedinvariantone pieceprovedremainingsubstantialunbrokenwholeprovenprovenceproveniencesubstantiatingsubstantiationvindicatedprovandprovectionprovedorprovedoreprovedoresprovendprovendsprovinedproviningsteadingssteadssubstantiatedcompellingcrispimplicativesinuouszigzagconvolutedcrabbedkinkyknottedmeanderoustortiletwistedwhorledwindingwryhard heartedhornyinsensiblemorosesurlyembryonicinelegantinexpertpuerileundressedunperfectunsoundcrabbyferventfuriouskeentuberscurdleembedestablishimplantthickenenfreezecuttinggliblymordaciouspipingpiquantrakishrallysharp pointedsmarttarttangytremendoustrenchantvividacidacridactiveacutebriskcausticcleveredgyfeistyfieryglibhotkeen wittednippingpiercingpoignantpungentquickrapidsharpshrillspicyspryspunkswankwing footedyarezappyacceleratedaculeatedbrakybrisantbrisk upbriskenexpeditiousfipplefurringhecticheft upimpoundingintensifiedlarcenouslasherostensivequickersharpenedsharpyshirtysnappyspadefulspankerspankingspeedingspirantspunkytorrentialacuminatedagoutybriskedbriskenedbriskeningbriskerbriskestbriskingeerierexpeditedexpeditivefadyfastishfastuousfeasterferreousfientflattishflintilyfliskfliskyflongflouncyflukingfurfurousfurzygliskhypurallarkylusklustiermusaceouspaceypalpatedpanderlypanderouspanduratedpandyingpiskyplouteredpulverousquakyquiverishripplierripplinglyripplyruddyingsharkedsharnysharpedsharperssharpishsmittlespanglerspanglingspankinglyspankingsspathulatespatteespatularspatulespeaningspedspeededspeedfulspeedlessspeeredspeiredspewedspewinessspewyspielingspikingspiratedspirewisesplentsplentingspoliatoryspongioussprightingsprucingspuddyspurryspurtlesteedysteenedsteeredstreamystridstriddenstrodestroutingsurfeitedsurgefulswardyupblowinguppingaccouteringblustrousdashydrastyfascetfastigiatedferulaceousimpanatedincendiousincensiveinfandouslusteringpiaculouspulverulentradiousriparioussharp wittedsharplingspatiatespeecespirablespritefulspritelythrettyspeeded upfoppishgallantgarishgaudygayglaringshowysuperbtawdrymeretriculouszootyassiduoushardworkingindustriouspainstakingindustriousnessworkfullaborousdimgloomymistfulmurkynebulousopacousopaquesemi opaquecloudyfoggyfuzzyhazylacklustremistyumbrageousunclearunclearedfuggymattematte upblorefadelessfadesfoglessforasmuchfuglefumymattesdisconsolatedispleaseglumjoylesslugubriousmopishdolefuldolourousdrearyghastfulhaplessmirkypensivesadsorrowfultristunhappygloomfulgloomedgloomiestgloomingsgloomsdisquiet impatientanxiousfidgetylackadaisicalnervousrestlessuncomfortableuneasyanfractuousanurousaphasicavidlychangelesschinlessetiolatedfroreinebriatedlangbeinitenonvolatilepantropicalperviousporousnessravishinglyrestlesslyunbaffledunburiedunchivalrousunchivalrouslyuneagerunemotionalunexhaustedunflavoredunflavouredunglamorousunglazedunguiculatedunicuspidunkindledunnervingunpressedunquietunsavoryunsteadinessunstimulatingunstresseduntangledunvoiceduraniniteanandrousanourousaposporousbelfriedchainlesschapelesschaplesschieflesscloylessdisceddisplosiondisquietlyexpatiatedfriarlyimbasedimpatiensinnervatedlapidatedlapidatinglapidifiedlavishingpanfulpangamicpanglesspotheryrameousrampaciousramulousrappelledravishedringinglyruderyrudishrumblysaclesssapidlesssheathlesssinewlessstresslessteemlesstenselessthatchlessturbidlyunadoredunanxiousuncostlyunctuosityundeploreduneasieruneasiestungainlierunghostlyungivingunglueungluedungoredungowningunguentsungyvedunhastyunmooredunmooringunsettlesunsteelingunsworeuntidyingunwiredunyokedupleadamurcousanenterousarenariousavarousavisefuldaedalousdisparadisedextirpatoryextuberantfatiloquentflabileindebtinginfestuousinlandishirresilientlapidariousrattle brainedrattle patedrecomfortlessreteciousribaudroussaccharousuberousuncousuncypherunpatientuntwirlvafrousvinagrousvolaciousdrasticoverpoweringterrifictellingvitallywild eyedintensionalfioritureintensatedintensitiveextremestulcerouslyultroneouseagerenthusiasticracyaficionadoenthusiasisticimpassionedpassionateriotousromanticalspunkeyvivacewarmunspeakabletoo baderroneousimpropermisdelusionalfallowflawedinaccurateincorrectmistakenundueunfairwrongwrongfulamissfauxfoul outimpreciselymalposedmiscuemisestimatemismatederrederumpentmisaimmisaimedmisalignedmisalliedmiscalledmiscuedmiscuingmisdatedmisdialmisdidmiseremiseresmisesmisfittedmisformedmisintendmiskeyedmispleasedmisquotedmisratedmisratesmisratingmisseemistedmisteredmistiermistimedmiswentperjuriousperjurouswrongingwrongouseversefalwemiskenmisrendermisrepeatmisseekmiswedmisyuncorrectfishyegyptian unrelentingegyptempirictentativepreliminarytempestivetestudinaltrialisttrialiststestamentaltestudinarioustestudineoustriedraltrietericaltenablesecurestablechoragicconsolidativedirigiblerock steadysetaceoussolidifiedstabilisedstabilizedstablematesteady goingsteadyingsustentacularconsilientconsonousstablerstableststatablestaticallysteadedsteadierconsolidantconsubstantialistconsubstantiatedintestableostentivepedetentousminutethickcriticaldeepdelicatefine nicescholasticsubtlethinzestfulenough amplyfull scalereplenishedwholeheartedwholesomein fullenegeticmammothministerialoverbearingmonumentaltremendouslyfeateousthrongfultroutfulturribantimmovableerectperpendicularperpetualstagnantstandingstationaryuprightinstitutedfedupvexedannoyeddejectedlamentablemoodytroubledwannestleinhabitsettle downfirst handflushmodernneotericalnewpuntfreshnovelrecentunconventionalyoung bloodnivosedebutantneanicnewednewernewingnewsedthewyennewnevewmatureveteranauthenticcompletecookedcunningdefinitedefinitivedetermineddevoutexperiencedfullgenuinehard boiledhard headedironcladloyalmaturedorthopermanentreadyrealreliableripeshrewdsincereweatheredpuckapukapicasfloppyindelibleconcupyfulsomeindecorousraunchyunbefittingunbeseemingundignifiedunfittingpregustantostentatiousflamboyantglitteryjazzytheatricalviewypretentiousfigureheadflashgrandiosekitschmodalexhibitionistexhibitionisticexhibitivegamemagnanimousmanfulwarriorbravedoughtyguttyintrepidredoubtablevaliantvalorousgauzyimpalpabletennousslenderfinelyfineishapparentdisclosedknownmanifestnotoriousglutboringdistastefulhumdrumhurtfulindigestiblemonotonousmorbidrepellenttiresometiringunpalatableunpleasantunwholesomeperipetalousgrainedhomelyknaggysulkysullencooldry impersonalinsipidunceremoniousunsympatheticcostlyintolerablewearingconservativehard corehardlinehardlinershardwiredhard mouthedtut mouthedrigorousgrotesqueuncoinedunsuitablevulgarmisbehavedprimitiveuncutramalignominiousignominymirydisgracefulingloriousblushfulembarrassingroisterousblithefulscheticirremovableirreversibleirrevocableforthrightincontestableindispensableinescapableinevitableinvariableperemptoryunalterableunavoidableunwaveringadamanceirrevokableunmakablealtricalattalirrevolubleimpassibleimpassiveimperceptiblenumbpurblindapatheticcold bloodeddeaddeafinanimateindelicateindifferentinsensitiveinsentientlazynervelessstolidtorpidunconsciousunfeelingzonkedapatheticallyapheticinderalinsensatelyinsensiblyinsensitivelyunaestheticunsympatheticallyenhydrousinsensuousnumbednumbestnumbinglyunsympathyanisopetalousanodynousapatheticalcrassrabidintolerantpitilessprecisianprighardcorecuttersstotiousstrigildarkdazzledobscurestupefiedimperviousstiff heartedstout heartedill manneredirreverentmalapertoff colourqueanunbredunkindunmanneredimportunatelethaldeadlyfatal internecinemortallife threateningmortalizesfatalnessloculousligneouswoodycloistercloistersmilkbrave mancourageouslionocherwringerlionslionhoodquarrelousspleenfulninenewlyknaweneoknaw9obsceneexactingrepressiveossificationwrathierwrathiestparanoidalbolddauntlessfearlessoutspokenpresumptiousdiestrousdomineeringdomineeringlybobblydaikeringdomineereddomineerssubduingdomifydomitableenbattledoverrunningsupercuriousundermoneyedlabourerperfectattachedstrengthenedwisesolemnisationfirmedmatlowmaturatedsolemnersolemnestsolemnisedsolemnisessolemnizedstaunchestaguiltruthlessinhumanerelentlessuncharitablemercurousimpassionableunpassionatebloodlessfeelinglesscallousedweightedweightierweightiestweightdioeciousequivocalnessprecociousditheisticmuticoustrifariousyoickedantisocialistarenulousaugurousconfervouscoralligenouscoralligerouscorolliflorousdentiferousdicaciousditheisticaleruginousfrugivorousinconsistingmelligenousmiasmaticalpotulentprenunciousstirioussuctoriousterrestriousvitelligenousvitiousslap dashwastefullywastefulnessblindingextravagantindiscriminateprecipitatelypromiscuousundiscriminatingindiscreteindiscriminatelyindraughtindraughtsincindentalindigitatedindigitatingindiscriminativeindiscussedindispersedindisposingindisputedindoctrinatedperseveringundeterredunflinchingstand firmsteadiedsteadiestacrimoniousaustereinelasticinductileiron boundstarktensetightlydrawnhunky doryinviolatestraightclearfortifiedinconvertibleunambiguousabidingalertfat healthyvirileangerxianbruisedcrushedmangledsquashedpichicoarsefelongallinggruffgrumcrookedmeanderingtenueslavaturealmaspraiseworthyvirtuousheraheertoweringultimateuttermostviolatorstrong willedtenablenesspersiennepersistivegenerouspureunbiasedlusterlessunselfunselfedunselfingunselfshailrocksilentstonestone coldstone soberstoneflystonerasmoulderbouldersmoulderspebblierpouldronpouldronsrocksstiletstonehandstonesstonkspoulderstone stillstonebowunburdenedbuddledburdenouslumbersomebournousslavishloudmouthvoicefulloudishnon compromisingresurrectiontumultturmoiluproarresurrectturbulenttough minded
Idioms with the word sakht - سخت in it
Idioms related to the meaning of sakht - سخت
What are the meanings of sakht - سخت in English?
Meanings of the word sakht - سخت in English are aggravated, arduous, consolidated, cruel, diamond, difficult, drastic, egregious, firm, grim, horny, impenitent, impetuous, morose, obdurate, operose, oppressive, outrageous, raw, rigid, severe, strict, strong, sturdy, stiff, stringent, stony, taut, vehement, violent, wooden, argentous, callous, exacting, extreme, flinty, hard, hardening, harsh, heathenish, heavy, high handed, inclement, indurate, inelastic, inexorable, inflexible, intense, ironclad, laborious, lacrimal, loud, nipping, raucous, ribless, rigout, scrumptious, scrumpy, sorbent, sternutative, sternutatory, stiffener, stratified, strengthened, stumpy, toilsome, tough, toughened, touter, trying, unbending, uncompromising, unmerciful, wrothful, durst, fiercer, fiercest, fierier, foughty, fructuous, harrowed, harshened, hushy, mordent, severer, sterner, sternitic, sternward, stied, stiffened, stiffer, stiffish, stillest, stiver, stoor, stratous, streperous, strich, stricter, strictured, stridulant, stridulous, strifeful, stripeless, strumatic, strumous, struthious, strutted, tartareous, tatous, tattier, tautened, tightened, tightens, tighter, toilful, torminous, torrefied, toughener, tougheners, toughening, tougher, toughish, touzle, touzled, touzling, trothful, tushy, verrucous, constringent, dureful, efferous, enervous, harborous, liefsome, piligerous, quercite, rigidulous, roboreous, slent, sordiferous, stibious, strigous, strude, stupeous, sturk, swough, tartarous, tentiginous, teretous, tergeminous, terreous, tonous, tureenful, ustorious, wieldsome and rigourous. To understand how would you translate the word sakht - سخت in English, you can take help from words closely related to sakht - سخت or it’s English translations. Some of these words can also be considered sakht - سخت synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word sakht - سخت. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use sakht - سخت in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say sakht - سخت in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of sakht - سخت with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by سخت?
Meanings of سخت are aggravated, arduous, consolidated, cruel, diamond, difficult, drastic, egregious, firm, grim, horny, impenitent, impetuous, morose, obdurate, operose, oppressive, outrageous, raw, rigid, severe, strict, strong, sturdy, stiff, stringent, stony, taut, vehement, violent, wooden, argentous, callous, exacting, extreme, flinty, hard, hardening, harsh, heathenish, heavy, high handed, inclement, indurate, inelastic, inexorable, inflexible, intense, ironclad, laborious, lacrimal, loud, nipping, raucous, ribless, rigout, scrumptious, scrumpy, sorbent, sternutative, sternutatory, stiffener, stratified, strengthened, stumpy, toilsome, tough, toughened, touter, trying, unbending, uncompromising, unmerciful, wrothful, durst, fiercer, fiercest, fierier, foughty, fructuous, harrowed, harshened, hushy, mordent, severer, sterner, sternitic, sternward, stied, stiffened, stiffer, stiffish, stillest, stiver, stoor, stratous, streperous, strich, stricter, strictured, stridulant, stridulous, strifeful, stripeless, strumatic, strumous, struthious, strutted, tartareous, tatous, tattier, tautened, tightened, tightens, tighter, toilful, torminous, torrefied, toughener, tougheners, toughening, tougher, toughish, touzle, touzled, touzling, trothful, tushy, verrucous, constringent, dureful, efferous, enervous, harborous, liefsome, piligerous, quercite, rigidulous, roboreous, slent, sordiferous, stibious, strigous, strude, stupeous, sturk, swough, tartarous, tentiginous, teretous, tergeminous, terreous, tonous, tureenful, ustorious, wieldsome and rigourous
Whats the definition of سخت?
Definition of the سخت are
- made more severe or intense especially in law
- incited, especially deliberately, to anger
- difficult to accomplish; demanding considerable mental effort and skill
- taxing to the utmost; testing powers of endurance
- characterized by effort to the point of exhaustion; especially physical effort
- forming a solid mass
- joined together into a whole
- (of persons or their actions) able or disposed to inflict pain or suffering
- a transparent piece of diamond that has been cut and polished and is valued as a precious gem
- very hard native crystalline carbon valued as a gem
- the area of a baseball field that is enclosed by 3 bases and home plate
- the baseball playing field
- a playing card in the minor suit that has one or more red rhombuses on it
- a parallelogram with four equal sides; an oblique-angled equilateral parallelogram
- not easy; requiring great physical or mental effort to accomplish or comprehend or endure
- hard to control
- forceful and extreme and rigorous
- conspicuously and outrageously bad or reprehensible
- securely fixed in place
- make taut or tauter
- become taut or tauter
- marked by firm determination or resolution; not shakable
- not subject to revision or change
- not liable to fluctuate or especially to fall
- (of especially a person's physical features) not shaking or trembling
- strong and sure
- unwavering in devotion to friend or vow or cause
- not soft or yielding to pressure
- with resolute determination
- the members of a business organization that owns or operates one or more establishments
- possessing the tone and resiliency of healthy tissue
- filled with melancholy and despondency
- having horns or hornlike projections
- feeling great sexual desire
- made of horn (or of a substance resembling horn)
- not penitent or remorseful
- impervious to moral persuasion
- marked by violent force
- characterized by undue haste and lack of thought or deliberation
- characterized by effort to the point of exhaustion; especially physical effort
- marked by unjust severity or arbitrary behavior
- weighing heavily on the senses or spirit
- grossly offensive to decency or morality; causing horror
- greatly exceeding bounds of reason or moderation
- unpleasantly cold and damp
- not processed or subjected to analysis
- devoid of elaboration or diminution or concealment; bare and pure
- informal terms for nakedness
- having the surface exposed and painful
- untempered and unrefined
- not processed or refined
- not treated with heat to prepare it for eating
- brutally unfair or harsh
- (used informally) completely unclothed
- used of wood and furniture
- (used especially of commodities) being unprocessed or manufactured using only simple or minimal processes
- incapable of compromise or flexibility
- incapable of or resistant to bending
- designating an airship or dirigible having a form maintained by a stiff unyielding frame or structure
- incapable of adapting or changing to meet circumstances
- fixed and unmoving
- very strong or vigorous
- intensely or extremely bad or unpleasant in degree or quality
- very bad in degree or extent
- severely simple
- incapable of compromise or flexibility
- rigidly accurate; allowing no deviation from a standard
- (of rules) stringently enforced
- severe and unremitting in making demands
- characterized by strictness, severity, or restraint
- strong and sure
- not faint or feeble
- of verbs not having standard (or regular) inflection
- having strength or power greater than average or expected
- freshly made or left
- having a strong physiological or chemical effect
- having or wielding force or authority
- of good quality and condition; solidly built
- being distilled rather than fermented; having a high alcoholic content
- immune to attack; incapable of being tampered with
- having rugged physical strength; inured to fatigue or hardships
- substantially made or constructed
- not making concessions
- extremely
- rigidly formal
- the dead body of a human being
- marked by firm determination or resolution; not shakable
- incapable of or resistant to bending
- having a strong physiological or chemical effect
- an ordinary man
- not moving or operating freely
- powerful
- in a stiff manner
- demanding strict attention to rules and procedures
- abounding in rocks or stones
- hard as granite
- pulled or drawn tight
- marked by extreme intensity of emotions or convictions; inclined to react violently; fervid
- characterized by great force or energy
- characterized by violence or bloodshed
- marked by extreme intensity of emotions or convictions; inclined to react violently; fervid
- (of colors or sounds) intensely vivid or loud
- effected by force or injury rather than natural causes
- acting with or marked by or resulting from great force or energy or emotional intensity
- made or consisting of (entirely or in part) or employing wood
- lacking ease or grace
- relating to compounds in which silver is univalent
- make insensitive or callous; deaden feelings or morals
- emotionally hardened
- having calluses; having skin made tough and thick through wear
- having complicated nutritional requirements; especially growing only in special artificial cultures
- severe and unremitting in making demands
- requiring precise accuracy
- the furthest or highest degree of something
- the point located farthest from the middle of something
- most distant in any direction
- of the greatest possible degree or extent or intensity
- beyond a norm in views or actions
- far beyond a norm in quantity or amount or degree; to an utmost degree
- containing flint
- not easy; requiring great physical or mental effort to accomplish or comprehend or endure
- with firmness
- very strong or vigorous
- causing great damage or hardship
- (of light) transmitted directly from a pointed light source
- dried out
- unfortunate or hard to bear
- resisting weight or pressure
- dispassionate
- given to excessive indulgence of bodily appetites especially for intoxicating liquors
- produced without vibration of the vocal cords
- with effort or force or vigor
- slowly and with difficulty
- earnestly or intently
- with pain or distress or bitterness
- very near or close in space or time
- into a solid condition
- indulging excessively
- characterized by effort to the point of exhaustion; especially physical effort
- (of speech sounds); produced with the back of the tongue raised toward or touching the velum
- being distilled rather than fermented; having a high alcoholic content
- to the full extent possible; all the way
- the process of becoming hard or solid by cooling or drying or crystallization
- the act of making something harder (firmer or tighter or more compact)
- abnormal hardening or thickening of tissue
- sharply disagreeable; rigorous
- of textures that are rough to the touch or substances consisting of relatively large particles
- unkind or cruel or uncivil
- unpleasantly stern
- unpleasantly rough or jarring to the senses
- (used of soil) compact and fine-grained
- in an advanced stage of pregnancy
- permitting little if any light to pass through because of denseness of matter
- usually describes a large person who is fat but has a large frame to carry it
- (of sleep) deep and complete
- prodigious
- given to excessive indulgence of bodily appetites especially for intoxicating liquors
- slowly as if burdened by much weight
- a serious (or tragic) role in a play
- an actor who plays villainous roles
- lacking lightness or liveliness
- requiring or showing effort
- sharply inclined
- dense or inadequately leavened and hence likely to cause distress in the alimentary canal
- of comparatively great physical weight or density
- unusually great in degree or quantity or number
- of great intensity or power or force
- slow and laborious because of weight
- full and loud and deep
- made of fabric having considerable thickness
- of relatively large extent and density
- (of an actor or role) being or playing the villain
- characterized by effort to the point of exhaustion; especially physical effort
- full of; bearing great weight
- large and powerful; especially designed for heavy loads or rough work
- marked by great psychological weight; weighted down especially with sadness or troubles or weariness
- (physics, chemistry) being or containing an isotope with greater than average atomic mass or weight
- of the military or industry; using (or being) the heaviest and most powerful armaments or weapons or equipment
- given to haughty disregard of others
- (of weather or climate) severe
- used of persons or behavior; showing no clemency or mercy
- emotionally hardened
- become hard or harder
- make hard or harder
- become fixed or established
- cause to accept or become hardened to; habituate
- not elastic
- impervious to pleas, persuasion, requests, reason
- incapable of adapting or changing to meet circumstances
- resistant to being bent
- incapable of change
- not making concessions
- (of color) having the highest saturation
- possessing or displaying a distinctive feature to a heightened degree
- extremely sharp or severe
- inflexibly entrenched and unchangeable
- a wooden warship of the 19th century that is plated with iron or steel armor
- sheathed in iron plates for protection
- characterized by effort to the point of exhaustion; especially physical effort
- relating to or located near the organ that produces tears
- of or relating to tears
- with relatively high volume
- characterized by or producing sound of great volume or intensity
- (used chiefly as a direction or description in music) loud; with force
- capable of wounding
- pleasantly cold and invigorating
- disturbing the public peace; loud and rough
- unpleasantly loud and harsh
- having no ribs or no visible ribs
- a person's costume (especially if bizarre)
- extremely pleasing to the sense of taste
- strong cider (as made in western England)
- a material that sorbs another substance; i.e. that has the capacity or tendency to take it up by either absorption or adsorption
- causing sneezing
- a chemical substance that causes sneezing and coughing and crying
- causing sneezing
- tending to cause sneezing
- material used for stiffening something
- deposited or arranged in horizontal layers
- (used of society) socially hierarchical
- arranged in a sequence of grades or ranks
- given added strength or support
- short and thick; as e.g. having short legs and heavy musculature
- characterized by effort to the point of exhaustion; especially physical effort
- a cruel and brutal fellow
- an aggressive and violent young criminal
- substantially made or constructed
- unfortunate or hard to bear
- someone who learned to fight in the streets rather than being formally trained in the sport of boxing
- resistant to cutting or chewing
- physically toughened
- not given to gentleness or sentimentality
- violent and lawless
- feeling physical discomfort or pain ( tough' is occasionally used colloquially for bad')
- making great mental demands; hard to comprehend or solve or believe
- very difficult; severely testing stamina or resolution
- made hard or flexible or resilient especially by heat treatment
- physically toughened
- someone who advertises for customers in an especially brazen way
- extremely irritating to the nerves
- hard to endure
- incapable of adapting or changing to meet circumstances
- not making concessions
- having or showing no mercy
- vehemently incensed and condemnatory
- قُوت اور تشدد سے کام لیتے ہوۓ
- مُحتاط طور پر حدود کے اندر اندر
- شدید جِسمانی قُوَّت سے مُتعلِّق
What is the synonym of سخت?
Synonym of word سخت are بھاری, بڑا, سخت, سنگین, کٹھن, مشکل, کام, کشٹ, دشوار, بکٹ
What are the idioms with the word سخت?
Here are the idioms with the word سخت in them.
- Never shirk the hardest work
- One good word can warm three winter months
- An unruly patient makes a harsh physician
- Burn the midnghi oil
- Do not be frightened by difficulties
What are the idioms related to سخت?
Here are the idioms that are related to the word سخت.
- He cannot be strict in judging who does not wish others to be strict in judging him
- Extreme justice is often extreme injustice
- It is difficult to be strong and not rash
- By trying the greeks got into troy
- It is a sweet sorrow to bury an outrageous wife