Taiz - تیز meanings in English
Taiz - تیز meanings in English are cutting, fervent, fierce, furious, glibly, impetuous, mordacious, piping, piquant, rakish, rally, sharp pointed, smart, speedy, tart, tangy, tempestuous, tremendous, trenchant, vehement, vivid, violent, acid, acrid, active, acute, brainy, brisk, caustic, clever, edgy, fast, feisty, fiery, glib, hot, intense, keen, keen witted, lively, loud, nipping, piercing, poignant, pungent, quick, rapid, sharp, shrill, spicy, spry, spunk, strong, swank, wing footed, yare, zappy, zippy, accelerated, aculeated, braky, brisant, brisk up, brisken, expeditious, fipple, furring, hectic, heft up, impounding, intensified, larcenous, lasher, ostensive, quicker, sharpened, sharpy, shirty, snappy, spadeful, spanker, spanking, speeding, spirant, spunky, torrential, acuminated, agouty, brisked, briskened, briskening, brisker, briskest, brisking, eerier, expedited, expeditive, fady, fastish, fastuous, feaster, ferreous, fient, flattish, flintily, flisk, flisky, flong, flouncy, fluking, furfurous, furzy, glisk, hypural, larky, lusk, lustier, musaceous, pacey, palpated, panderly, panderous, pandurated, pandying, pisky, ploutered, pulverous, quaky, quiverish, ripplier, ripplingly, ripply, ruddying, sharked, sharny, sharped, sharpers, sharpish, smittle, spangler, spangling, spankingly, spankings, spathulate, spattee, spatular, spatule, speaning, sped, speeded, speedful, speedless, speered, speired, spewed, spewiness, spewy, spieling, spiking, spirated, spirewise, splent, splenting, spoliatory, spongious, sprighting, sprucing, spuddy, spurry, spurtle, steedy, steened, steered, streamy, strid, stridden, strode, strouting, surfeited, surgeful, swardy, upblowing, upping, accoutering, blustrous, dashy, drasty, fascet, fastigiated, ferulaceous, impanated, incendious, incensive, infandous, lustering, piaculous, pulverulent, radious, riparious, sharp witted, sharpling, spatiate, speece, spirable, spriteful, spritely, thretty, speeded up Taiz - تیز in English. More meanings of taiz - تیز, it's definitions, example sentences, related words, idioms and quotations.
cutting fervent fierce furious glibly impetuous mordacious piping piquant rakish rally sharp pointed smart speedy tart tangy tempestuous tremendous trenchant vehement vivid violent acid acrid active acute brainy brisk caustic clever edgy fast feisty fiery glib hot intense keen keen witted lively loud nipping piercing poignant pungent quick rapid sharp shrill spicy spry spunk strong swank wing footed yare zappy zippy accelerated aculeated braky brisant brisk up brisken expeditious fipple furring hectic heft up impounding intensified larcenous lasher ostensive quicker sharpened sharpy shirty snappy spadeful spanker spanking speeding spirant spunky torrential acuminated agouty brisked briskened briskening brisker briskest brisking eerier expedited expeditive fady fastish fastuous feaster ferreous fient flattish flintily flisk flisky flong flouncy fluking furfurous furzy glisk hypural larky lusk lustier musaceous pacey palpated panderly panderous pandurated pandying pisky ploutered pulverous quaky quiverish ripplier ripplingly ripply ruddying sharked sharny sharped sharpers sharpish smittle spangler spangling spankingly spankings spathulate spattee spatular spatule speaning sped speeded speedful speedless speered speired spewed spewiness spewy spieling spiking spirated spirewise splent splenting spoliatory spongious sprighting sprucing spuddy spurry spurtle steedy steened steered streamy strid stridden strode strouting surfeited surgeful swardy upblowing upping accoutering blustrous dashy drasty fascet fastigiated ferulaceous impanated incendious incensive infandous lustering piaculous pulverulent radious riparious sharp witted sharpling spatiate speece spirable spriteful spritely thretty speeded up
Taiz - تیز Definitions
Please find 246 English and 6 Urdu definitions related to the word Taiz - تیز.
- (noun) : street name for lysergic acid diethylamide
- (noun) : any of various water-soluble compounds having a sour taste and capable of turning litmus red and reacting with a base to form a salt
- (adjective satellite) : having the characteristics of an acid
- (adjective satellite) : being sour to the taste
- (adjective satellite) : strong and sharp
- (noun) : the voice used to indicate that the grammatical subject of the verb is performing the action or causing the happening denoted by the verb
- (noun) : chemical agent capable of activity
- (adjective satellite) : taking part in an activity
- (adjective satellite) : engaged in or ready for military or naval operations
- (adjective) : engaged in full-time work
- (adjective) : full of activity or engaged in continuous activity
- (adjective) : tending to become more severe or wider in scope
- (adjective) : disposed to take action or effectuate change
- (adjective) : (of e.g. volcanos) erupting or liable to erupt
- (adjective satellite) : in operation
- (noun) : a person who is a participating member of an organization
- (adjective) : (of e.g. volcanos) capable of erupting
- (adjective) : exerting influence or producing a change or effect
- (adjective) : (of the sun) characterized by an increased occurrence of sunspots and flares and radio emissions
- (adjective) : (used of verbs (e.g. to run') and participial adjectives (e.g. running' in running water')) expressing action rather than a state of being
- (adjective) : expressing that the subject of the sentence has the semantic function of actor:
- (adjective) : of an angle; less than 90 degrees
- (adjective) : having or experiencing a rapid onset and short but severe course
- (adjective satellite) : of critical importance and consequence
- (adjective satellite) : ending in a sharp point
- (noun) : a mark placed above a vowel to indicate pronunciation
- (adjective satellite) : extremely sharp or severe
- (verb) : become brisk
- (adjective satellite) : very active
- (adjective satellite) : quick and energetic
- (adjective satellite) : imparting vitality and energy
- (noun) : any chemical substance that burns or destroys living tissue
- (adjective satellite) : mentally quick and resourceful
- (adjective satellite) : showing self-interest and shrewdness in dealing with others
- (adjective satellite) : showing inventiveness and skill
- (adjective satellite) : unpleasantly cold and damp
- (noun) : the act of cutting something into parts
- (noun) : the act of penetrating or opening open with a sharp edge
- (noun) : the division of a deck of cards before dealing
- (noun) : the act of diluting something
- (noun) : a piece cut off from the main part of something
- (noun) : a part (sometimes a root or leaf or bud) removed from a plant to propagate a new plant through rooting or grafting
- (noun) : the activity of selecting the scenes to be shown and putting them together to create a film
- (noun) : an excerpt cut from a newspaper or magazine
- (adjective satellite) : (of speech) harsh or hurtful in tone or character
- (noun) : removing parts from hard material to create a desired pattern or shape
- (noun) : the act of shortening something by chopping off the ends
- (adjective satellite) : painful as if caused by a sharp instrument
- (adjective satellite) : unrestrained by convention or morality
- (noun) : abstaining from food
- (verb) : abstain from eating
- (verb) : abstain from certain foods, as for religious or medical reasons
- (adjective satellite) : resistant to destruction or fading
- (adjective satellite) : (of surfaces) conducive to rapid speeds
- (adjective) : acting or moving or capable of acting or moving quickly
- (adjective) : at a rapid tempo
- (adjective) : (used of timepieces) indicating a time ahead of or later than the correct time
- (adjective satellite) : securely fixed in place
- (adjective satellite) : hurried and brief
- (adverb) : quickly or rapidly (often used as a combining form)
- (adjective satellite) : unwavering in devotion to friend or vow or cause
- (adjective satellite) : (of a photographic lens or emulsion) causing a shortening of exposure time
- (adverb) : firmly or closely
- (adjective satellite) : (archaic) extremely hot, burning, or glowing
- (adjective satellite) : showing courage
- (adjective satellite) : quick to take offense
- (adjective satellite) : marked by extreme and violent energy
- (adjective satellite) : marked by extreme intensity of emotions or convictions; inclined to react violently; fervid
- (adjective satellite) : ruthless in competition
- (adjective satellite) : violently agitated and turbulent
- (adjective satellite) : like or suggestive of fire
- (adjective satellite) : marked by extreme and violent energy
- (adjective satellite) : marked by extreme anger
- (adjective satellite) : artfully persuasive in speech
- (adjective satellite) : having only superficial plausibility
- (adjective satellite) : marked by lack of intellectual depth
- (adverb) : with superficial plausibility
- (adjective satellite) : producing a burning sensation on the taste nerves
- (adjective satellite) : very fast; capable of quick response and great speed
- (adjective satellite) : of a seeker; very near to the object sought
- (adjective satellite) : marked by violent force
- (adjective satellite) : characterized by undue haste and lack of thought or deliberation
- (adjective satellite) : painful as if caused by a sharp instrument
- (adjective satellite) : quick and energetic
- (adjective satellite) : full of zest or vigor
- (adjective satellite) : filled with events or activity
- (adjective) : full of life and energy
- (adjective satellite) : elastic; rebounds readily
- (adjective satellite) : full of spirit; full of life
- (adjective satellite) : capable of wounding
- (adjective satellite) : biting or given to biting
- (noun) : a long tube made of metal or plastic that is used to carry water or oil or gas etc.
- (noun) : playing a pipe or the bagpipes
- (noun) : a thin strip of covered cord used to edge hems
- (adverb) : (used of heat) extremely
- (adjective satellite) : engagingly stimulating or provocative
- (adjective satellite) : attracting or delighting
- (adjective satellite) : arousing affect
- (adjective satellite) : keenly distressing to the mind or feelings
- (adjective satellite) : moving quickly and lightly
- (adjective satellite) : hurried and brief
- (noun) : any area of the body that is highly sensitive to pain (as the flesh underneath the skin or a fingernail or toenail)
- (adjective satellite) : apprehending and responding with speed and sensitivity
- (adjective satellite) : easily aroused or excited
- (adjective satellite) : accomplished rapidly and without delay
- (adverb) : with little or no delay
- (adjective satellite) : marked by a carefree unconventionality or disreputableness
- (adjective satellite) : marked by up-to-dateness in dress and manners
- (verb) : harass with persistent criticism or carping
- (verb) : call to arms; of military personnel
- (verb) : gather or bring together
- (noun) : the feat of mustering strength for a renewed effort
- (noun) : (sports) an unbroken sequence of several successive strokes
- (noun) : an automobile race run over public roads
- (noun) : a large gathering of people intended to arouse enthusiasm
- (noun) : a marked recovery of strength or spirits during an illness
- (verb) : return to a former condition
- (verb) : gather
- (noun) : a part of a river where the current is very fast
- (adjective satellite) : done or occurring in a brief period of time
- (adjective satellite) : characterized by speed; moving with or capable of moving with high speed
- (adjective satellite) : extremely steep
- (adjective satellite) : ending in a sharp point
- (noun) : a long thin sewing needle with a sharp point
- (noun) : a musical notation indicating one half step higher than the note named
- (adjective satellite) : harsh
- (adjective) : having or made by a thin edge or sharp point; suitable for cutting or piercing
- (adjective) : keenly and painfully felt; as if caused by a sharp edge or point
- (adjective satellite) : quick and forceful
- (adjective satellite) : very sudden and in great amount or degree
- (adjective satellite) : marked by practical hardheaded intelligence
- (adjective satellite) : (of something seen or heard) clearly defined
- (adverb) : changing suddenly in direction and degree
- (adjective satellite) : having or emitting a high-pitched and sharp tone or tones
- (adjective) : (of a musical note) raised in pitch by one chromatic semitone
- (adjective) : having a sharp point
- (verb) : utter a shrill cry
- (adjective satellite) : of colors that are bright and gaudy
- (adjective satellite) : being sharply insistent on being heard
- (adjective satellite) : having or emitting a high-pitched and sharp tone or tones
- (verb) : be the source of pain
- (adjective satellite) : characterized by quickness and ease in learning
- (adjective satellite) : elegant and stylish
- (adjective satellite) : improperly forward or bold
- (noun) : a kind of pain such as that caused by a wound or a burn or a sore
- (adjective) : showing mental alertness and calculation and resourcefulness
- (adjective satellite) : capable of independent and apparently intelligent action
- (adjective satellite) : quick and brisk
- (adjective satellite) : painfully severe
- (adjective satellite) : accomplished rapidly and without delay
- (adjective satellite) : characterized by speed; moving with or capable of moving with high speed
- (adjective satellite) : suggestive of sexual impropriety
- (adjective satellite) : producing a burning sensation on the taste nerves
- (noun) : the courage to carry on
- (noun) : material for starting a fire
- (adjective satellite) : moving quickly and lightly
- (adjective satellite) : strong and sure
- (adjective satellite) : not faint or feeble
- (adjective satellite) : of verbs not having standard (or regular) inflection
- (adjective) : having strength or power greater than average or expected
- (adjective satellite) : freshly made or left
- (adjective) : having a strong physiological or chemical effect
- (adjective satellite) : having or wielding force or authority
- (adjective satellite) : of good quality and condition; solidly built
- (adjective satellite) : being distilled rather than fermented; having a high alcoholic content
- (adjective satellite) : immune to attack; incapable of being tampered with
- (adjective satellite) : harsh
- (noun) : a small open pie with a fruit filling
- (adjective satellite) : tasting sour like a lemon
- (noun) : a pastry cup with a filling of fruit or custard and no top crust
- (adjective satellite) : tasting sour like a lemon
- (adjective satellite) : characterized by violent emotions or behavior
- (adjective satellite) : extraordinarily large in size or extent or amount or power or degree
- (adjective satellite) : extreme in degree or extent or amount or impact
- (adjective satellite) : extraordinarily good or great; used especially as intensifiers
- (adjective satellite) : clearly or sharply defined to the mind
- (adjective satellite) : having keenness and forcefulness and penetration in thought, expression, or intellect
- (adjective satellite) : characterized by or full of force and vigor
- (adjective satellite) : marked by extreme intensity of emotions or convictions; inclined to react violently; fervid
- (adjective satellite) : characterized by great force or energy
- (adjective satellite) : evoking lifelike images within the mind
- (adjective satellite) : having the clarity and freshness of immediate experience
- (adjective satellite) : (of color) having the highest saturation
- (adjective satellite) : having strong or striking color
- (adjective satellite) : characterized by violence or bloodshed
- (adjective satellite) : marked by extreme intensity of emotions or convictions; inclined to react violently; fervid
- (adjective satellite) : (of colors or sounds) intensely vivid or loud
- (adjective satellite) : effected by force or injury rather than natural causes
- (adjective) : acting with or marked by or resulting from great force or energy or emotional intensity
- (adjective satellite) : quick and energetic
- (adjective satellite) : marked by lively action
- (adjective satellite) : speeded up, as of an academic course
- (adjective) : having or resembling a stinger or barb
- (adjective satellite) : abounding with bracken
- (adjective satellite) : covered with brambles and ferns and other undergrowth
- (adjective) : of or relating to the power (the shattering effect) of an explosive
- (verb) : become brisk
- (verb) : become brisk
- (adjective satellite) : being in a tense state
- (adjective satellite) : marked by speed and efficiency
- (noun) : a wooden plug forming a flue pipe (as the mouthpiece of a recorder)
- (noun) : strip used to give a level surface for attaching wallboard
- (noun) : a furlike coating of matter as on the tongue
- (adjective satellite) : marked by intense agitation or emotion
- (verb) : lift or elevate
- (noun) : placing private property in the custody of an officer of the law
- (adjective satellite) : (of color) having the highest saturation
- (adjective) : possessing or displaying a distinctive feature to a heightened degree
- (adjective satellite) : extremely sharp or severe
- (adjective satellite) : made more intense
- (noun) : having a disposition to steal
- (noun) : a driver who urges the animals on with lashes of a whip
- (adverb) : with relatively high volume
- (adjective) : characterized by or producing sound of great volume or intensity
- (adjective) : (used chiefly as a direction or description in music) loud; with force
- (adjective satellite) : capable of wounding
- (adjective satellite) : pleasantly cold and invigorating
- (adjective satellite) : represented or appearing as such; pretended
- (adjective satellite) : manifestly demonstrative
- (adjective satellite) : painful as if caused by a sharp instrument
- (adjective satellite) : strong and sharp
- (adjective satellite) : capable of wounding
- (adverb) : more quickly
- (adjective satellite) : made sharp or sharper
- (adjective satellite) : having the point made sharp
- (noun) : an alert and energetic person
- (noun) : a professional card player who makes a living by cheating at card games
- (adjective satellite) : (British informal) ill-tempered or annoyed
- (adjective satellite) : quick and energetic
- (adjective satellite) : pleasantly cold and invigorating
- (adjective satellite) : marked by up-to-dateness in dress and manners
- (adjective satellite) : apt to speak irritably
- (adjective satellite) : smart and fashionable
- (noun) : a fore-and-aft sail set on the aftermost lower mast (usually the mizzenmast) of a vessel
- (noun) : a hitter who slaps (usually another person) with an open hand
- (adjective satellite) : quick and energetic
- (noun) : the act of slapping on the buttocks
- (noun) : changing location rapidly
- (noun) : a continuant consonant produced by breath moving against a narrowing of the vocal tract
- (adjective satellite) : of speech sounds produced by forcing air through a constricted passage (as f', s', z', or th' in both thin' and then')
- (adjective satellite) : showing courage
- (noun) : elegance by virtue of being fashionable
- (adjective satellite) : imposingly fashionable and elegant
- (adjective satellite) : pouring in abundance
- (adjective satellite) : resembling a torrent in force and abundance
- (adjective) : relating to or resulting from the action of a torrent
- مُختَصَر اور تیز مَرض میں شِدَّت
- جیسے دِل کا دورہ یا اسقاط کی وجہ سے خُون کا جاری ہونا یا مِعدے کا اچانَک بَڑھاو
- بہت اُونچی اور پردے بھاڑ آواز
- مُقامی لیکن عموماً سطحی سے درد کا باعِث ہونا
- بعض دھاتوں کو پَگھلا کر صاف کر کے حاصِل کیا جاتا ھے
- شدید جِسمانی قُوَّت سے مُتعلِّق
Example Sentences
They disappeared quickly | وہ تیزی سے غائب ہو جاتے تھے |
It shrunk quickly | یہ تیزی سے چھوٹا پڑ گیا |
More words related to the meanings of Taiz - تیز
More words from English related to Taiz - تیز
View an extensive list of words below that are related to the meanings of the word Taiz - تیز meanings in English in English.
abandonedcastawaydissoluteerrant erraticgadaboutmiscreantraffishrakishrakeribaldslipstringtrollopvagabondvagrantlydestitutehooliganprofligatestragstragglerstrollervagrantwackywandererwaywardwhackystrayablativehotafireable bodiedstrongstoutstalwartburlycanthaleheftynot illtoughwell builtwell fedmightyvigorousabnormaldisproportionalshrillquaintsingularextraordinary ... notablenovelphenomenaltremendousuncommonunconventionaluntypicalunusualabnormalcyabstentiousanomalistextraduralextragalacticextraordinaireextraordinarinessexuvialnonarborealnoncommunicablenonmetalnonnomadicsupernormaluncommercialuncommunicativenessunfasteninguninominalunusualnessabnormousabstrusestdecinormalexigeantextradotalextrorsalfabularflosculousforaminalfornenstfratchyparanoicuncinusuncommonerunfallenunordinaryabsinthialanormalexcambexcommunicableexcrementalexcrementitialextispiciousextraarticularextraordinariesextraregularextratropicalextravascularforaminiferousimmarginateincongenialnonmalignantoparcularpecunialporcellanousprenominateundernomunigenitureuniocularunusualityout of the ordinaryabateeffeteemaciatedflaccid flaggyfragilefrailimbecileimpotentimpairednerdpipingpithlessramshacklesleazywimpdebilitativefabledundermentionedvulnerablyweakenedweakenerfeeblerfeeblestfrailestfrailishfrailsweakenersweakerweazeneddebilitantweak heartedweakishweakablestcapablecompetentefficient giftedpre eminentproficientqualifiedablecleverdeservingmeritedmeritoriousreceptivetalentedworthfulworthyassailabledefinablemeritableablerabletaccablecapablerdecernedeffableenterablefigurablelosablemissablepassibleregardablesuableversifiedworthsprestablereeligibleregiblesperablevolitablecannycircumspectclerklydiscerningdiscreetknowingmindfulnattytactfulvigilantwakefulwarywatchfulalertawakeintelligentlearnedslickon the watchwide awakewittyawearybecominglyclaverslickersmarmilysmarmysmartingclevecleverdickcleverercleverestcleverishhowkerssensileshrewdestshrewdieslickenslickestsmarmedsmarmiersmarmingsmartedsmartenedsmartenssmartersmartestsmartishsmirkiestsmirredwittiestavilesmartleprudentdiligentearnest keenswiftaptpromptquickreadylustypeppylivelystrenuouszippyefficaciousenergeticovermatchcogentforcefulpotentsturdywallopingpotentisedpotentsquaveacerbityactivenessagilitycelerityescalationfierinessfleetnessforwardnessfriskinessfuriousnessglibnesshotnesshurryimpetuositykeennessmordacitypiercingnesspiquancypungencyvehemencevelocityzealotismacuityasperityclevernessflippancyfuryhasteheatlivelinessnimblenesspertnesspoignancyquicknessrapiditysharpnessspeedswiftnessvividnesvolatilityrapidnessexpeditenessrapacesfastacerosespikytaperacuteacuminatetangypointy toedacidaciditymischiefblundererrorfalling fault fiascofourguiltmisconceitmisgivingomissionparkagoraneglectquadrivialsquarevenial sinwrongyardchocsquarkquartesquareschoakacetatemustinessgruffnessacridpiquantbasketepidermis filmhymenmembraneveilwebmemberedmembralimbuementmembraniformactactiveactionverbdeedoperationpretencepretextworkverbenaverbosenessverbalsverberatesverbidverbidsverbsverismactoragentframer manageroperatorshirtconjurerobservanttetrarchfactoroperativefactorisefactorisedfactorizedcorrosiveactivelybrisklyfiercelyfleetlyfuriouslyfurlosogliblyimpetuouslykeenlypiercinglyprestorapidlyrashlytempestuouslyreadilydrasticallyexponentiallyluridlyrampantlyspeedilyspuriouslyswiftlybullishlydecadentlyfastlyfleetinglyraptlyrifelyrippinglyspeedfullyspikilystarrilythwartlyrapfullyspasticallyacerbicgingerhastyvehementaceticcrabbytartacerbsouracidulousbitingwingedearly earlinesscutaneouspost hastequicklyrapidskinnydropsyearlyishexpeditiousnesshurriednessjoltyquick wittednessquickyrattailruck uprush offgurgledhadsthaspinghastahastedhastenedhastenshastierhurcheonshurlieshurrayshurrieshurryingsjollifiedjollifiesjollitieslurrymercurizedquickiesrashesrasurerushinesssmurryurgenceurgercompurgationfumacioushastilehastivehurrierincelebritymercurificationraashrashlingscelesticwhurtaffectingmordaciousmordantwailfulaffectivehokeysusceptibilityyuckardentemotionalferventfieryimpassionateimpassionedlackadaisicallanguishingmaudlinmawkishmettlesomezealfulemmentalemotionalismemotionlesssensualizesentimentalistemmovingemotedemotingemulativeemuredemuringentheticerotesisfactivepassioningsentientsemotionedentreativeaffectionatefondaggravatedbulkydifficultearthy grandgrievousimportantirksomelethargiclumpishmassivemomentousoppressivetedioustrampburdensomecumbersomeheavyhugehulkylandslidelifelessloudonerousstodgyweightyheavyheartedheavierheaviesheftilyoutweepingwavierheaperheavisomeheavy headedhevedarduousconsolidateddiamonddrasticegregiousimpenitentimpetuousmoroseobdurateoperoseoutrageousrawstiffstringentstonycallouscruelexactingextremefirmflintygrimhardharshheathenishhigh handedhornyinclementindurateinelasticinexorableinflexibleintenseironcladlaboriousnippingrigidrigourousseverestrengthenedstricttauttryingunbendinguncompromisingunmercifulviolentwoodenargentoushardeninglacrimalraucousriblessrigoutscrumptiousscrumpysorbentsternutativesternutatorystiffenerstratifiedstumpytoilsometoughenedtouterwrothfuldurstfiercerfiercestfierierfoughtyfructuousharrowedharshenedhushymordentseverersternersterniticsternwardstiedstiffenedstifferstiffishstilleststiverstoorstratousstreperousstrichstricterstricturedstridulantstridulousstrifefulstripelessstrumaticstrumousstruthiousstruttedtartareoustatoustattiertautenedtightenedtightenstightertoilfultorminoustorrefiedtoughenertoughenerstougheningtoughertoughishtouzletouzledtouzlingtrothfultushyverrucousconstringentdurefulefferousenervousharborousliefsomepiligerousquerciterigidulousroboreousslentsordiferousstibiousstrigousstrudestupeoussturkswoughtartaroustentiginousteretoustergeminousterreoustonoustureenfulustoriouswieldsomebayonetgravemarble breastedseriousbayonetingbayonetsbayonettedfeloniesfelonousfelonryfelstonegravellinggriminggrimmercrucigerousgripefulagileenegeticlimberbriskfleetlissomeniftynimblesmartspryvolantcutelivingpickaxpickaxequirkysharpershiftyslyspeedyadroitastutecunningdeceitfuldeftexpertingeniousleerymanipulatortrickywilfulciliciousshrewdiestrickiertrickishtricklesstricksomecunningmandexterouscompactnarrowquick wittedtightsiliquoussedileagalactousagglutinatedagibleagminalaglowcleareffulgentflashyglitteringlucentlustrousshinysparkishbrightbrilliantfulgentgarishgaudyglossyluculentluminescentrutilantsheenshiningtawdryagogwarmenthusiastenthusiastsvivaciouswarm heartedzealousdashingzealotactivisticcrowdedruttishthermaleagerexcitedglowingheatedheat uphot upwarmedhetehotchhotchedhotenhottedhotteredwarmswarmfulagingfoggyimmemorialoldenthreadbareancientexperiencedinveteratelongstandingmoss grownoldold fashionedoutdatedoutmodedstaleusedvenerablewarmed overyesterolderoldisholdtimerparanapuranaoldenedoutdaringpranapuranasavidfancieramaturedevotedfondantskeenerscurioussharp setversedwishfulwistfulawfullygreatlygrosslyhugelymostovermuchparlousquiteseverelythoroughvastlyveryaboundingamplecopiousendexceedinglyexcessiveextremelyextremityhyperintenselylastlimitrifesteepbackbonedbutchflat footedfudiciarylingyoakystaunchvalidblowzybrawnydurableindissolublelastingresoluterobustrootedstabilesteadfaststeadyunmovedbolsteredfirmerstrongerstrongishstrongylstrongylestrongylsstrontiansturtingstrengerstrondstronghandstrongylidstruntianbanglebraceletimmalleableadamantanklethardenedhardyhoarsehorridimplacableinauspiciousrefractoryroughrudetenaciousunluckyunyieldingyeomanlybraceletsbrantlesbadasscorbeljoistlinkrafterversebeamhardshiplinkagenexussufferingkadibarbarianbrutalferineferocioustruculentwildanimalbarbarousbeastcrazyfierceimmaneinhumansavageunciviliseduncultivatedunculturedyahoobarbarianssavagedsavagedomsavagesbarbigerousbarbariousbarragebunbindingconfidentemphaticsurebitteracrimoniousbitter tastingembitteredpoignantpungentvitriolicwershbitternutgallingunpalatablebitterishbitternbittaclebitumedbremediluvial slanderousgushinggustygustfulstormytempestuouswindystorminessstorthingsurquedrousstormablebull headeddesultoryfoolhardyheadlongheadyprecipitatorprecipitousrashburngrudegeignitekindleflamelightmeetspunkburnsideembrittledurnjiltingpowerfulpuissantstrongmanwiryall powerfulblightybowerypotfulpowerfullymightfulmightierpotentatespottiestpowwowsstrongmenhighty tightypowerablesleightystrengthnernecromanceradultartfulgrown upshrewdsorcerertodwisecardinalgloriousgreatimmensemagnificentmainbigcolossalhighly dignifiedexaltedformidablegiantgigantichighhigh soundingimmeasurableimposinglargeloftymagnatemajesticpalatialprodigiousredoubtablesplendidunboundedcasemateembrasurerantipolewantonblackguarddrunkardfreethinkerlibertinetoperrindsrundcausticaqua fortisacid halideacinousacajousacidheadacidheadsacidifieracidsaciformacuminoushyliccarvingcorrosioncuttingerosionbitecountercounter movecutdamagedisconnectionenmityincisionlossrejoinderslashchop offcut outcut upcutoutcottcheekyfunnymalapertnaughtyvividboldcockycoltishdeepfacetiousflippantflirtfriskygayinsolentkittenishlasciviousmercurialmischievousperkypertpetulantplayfulsaucysportfultoysomevolatilecinchgirthlimitednarrowishclosecongesteddistressedharassedincapaciousstraitenedcrampednarrow downnarrowednarrowingstraitlacedanglicisedcrampetnarrowcastnarrowernarrowsstintystraggledstraikedstrampedtangedtantaloustightishweiredclear sightedclear sightednessdiscernmenttactacumenacutenessinsightnouspenetrationperceptionsagacityunderstandingwisdomwitclottedcoherentmotheryembeddedice boundinsistentclamantimmediatesuddenurgentinstantinstancyinstantaneousnessinstantiationsoonestinstancinginstantialinstantsimpromptinstantaneitytightlytightenconcretefraught impermeableimporousbrainysolidtersesolidarysolidestsolidschinnedsolidunguloustouzeadherentconglomeratecontinuousjoinedlinkednearnextpermanentstickingsolemncontemndisgrace disparageoutscornrallyphlogisticcorruptcorruptivefeloniousguiltymorbidnefariousspitefulnoxiousstagnantviciouscostiveboundtiedcourtesanhookerhustlerprostitutequeancall girldrabharlotmollharlotsprostylesprostitutorstrisoresprostitutescondimentseasonedspicycourageousgameconfigurationfigureguisemannermodemoraltenorappearancebehaviourcharacterchicdemeanourfashionfoundinggarbnatureposturesituationstancestatestylevoguemodiusmodussceattconsistentcertifiedconfirmedcorrectenduringestablishedfixedincorruptingrainedinvariantone pieceprovedremainingsoundsubstantialunbrokenwholeprovenprovenceproveniencesubstantiatingsubstantiationvindicatedprovandprovectionprovedorprovedoreprovedoresprovendprovendsprovinedproviningsteadingssteadssubstantiatedcompellingdivertive entertaining juicyabsorbingalluringcharmingdelightfulfascinatingingratiatinginterestinginvitingpleasantpleasingavirulentfascinatinglyfashiousintrigantintriguantintriguedluxatingattiguousentheasticexcitivefasciculatefascinousfurioustuberscurvateddandyfashion mongerfopgallantbeaubentcrookedcurvedfoppishjauntyraffharvestfishharvestingcroppingharvestedharvestspruningsharvestrydissectionkerfmakefabricrecisionracysulkyelegantfine piercingsprightlyclippingsnippetgeniushard headedhighbrowintellectualsagacioussharp wittedbrainiestcutterhewermowerfreshnewposhuniquefancifulfrivoloussportiveglaringshowysuperbmeretriculouszootydiscontentedlewdvillaindissipatedlecherlecherousprostituderakehelldebaucheelicentiousluxuriousdedicated to pleasureroistervoluptuousonlookerdissolutely immorallyimpiousimpiouslyirreligiouslywantonlyintemperateon the waydistinct evidentlimpidtransparentapparentblatantclear cutclearlyexplicitexpressgrosslegiblelucidmanifestmarkednudeobviouspronouncedtactileunmistakeablevisibleclearheadedconspicuousesurientevidentialevitablefrangibleopepepandurateperspicuousreferentblarneyedblathererclartyclearerclearesteidentelucidatedelusoryesterifiedevidentsevincedevincesevincingevinciveevoluteevolutivefrankedopificeropificersostentvividestdirgemoanmourningwailingjeremiadlamentationmonodylamentslateningwailmentlutelyrebetweenintervalbenbeindreadfulgrislydroll chess playergnostictacticiandrunklustfulmuzzyrapttipsycarelesshappy go luckyindifferentinebriantintoxicatedmadoverjoyedrampantoverpoweringterrificheinoustellingvitallywild eyedintensionalfioritureintensatedintensitivedying earthling fatal mortaltemporaltemporaryephemeralfleetingperishabledynamicimpellentkineticmotilemovablemovermovingprojectileprovocativemobileagamicalligatoredametabolousanimatedanimatingimmobilizinginvigoratedinvigoratingmobcapmoblikeactivatesaggradinganimalicanimateranimatersanimatesanimatorsdynamiseddynamisesdynamiteddynamitersdynamitingdynamizeddynamizesdynamotordynamotorsgamichomotonouskineticalmobblemobbledmobblesmobblingmobbymobilisedmobilisermobilisesmobilizedmobilizermobilizersmobilizesmobocratmobocraticmobocratsmotionedpotamictrigamoustriggedtriggeredtriggeringtriggerstriggesttriggingtrigynousvibronicagitableambulativeanimadversiveanimalishanimasticanimativedynametricaldynamometricdynamometricalinvaginatedmopefulmotificstiriatedstreamfulastaticeasyeffortlessfacileconvenientfeasibleglibmanageableold shoepainlesssimplifiedsimpsimperedsimperingsimperssimpledsimplersimplingconvellenteffigialeffodientsharplyvolumebinding of a bookcuticlecutisdermskinsoonvolumeof a bookprecipitatenessvolvolostskinchenthusiasticaficionadoenthusiasisticpassionateriotousromanticalspunkeyvivaceappetentdesirousshaikaspirantbent onoveranxioustenablesecurestablechoragicconsolidativedirigiblerock steadysetaceoussolidifiedstabilisedstabilizedstablematesteady goingsteadyingsustentacularconsilientconsonousstablerstableststatablestaticallysteadedsteadierconsolidantconsubstantialistconsubstantiatedintestableostentivepedetentousenormousmammothovergrownwhackingwhoppinggigantismtoo largegiganticalgiganticidegigantomachysupercretaceousenterprisingmanfulvalorousventuresomebravedoughtyguttyintrepidmanlyvaliancevaliantventurouszestfulperkwholeheartedzappyecstaticalcorbelledcormousenshroudexcitableexcitantexmoorexultantpejorativesusurrousarrestivecalmativecaressiveconcussivedeliriantexactedexsiccantexuberatedfossedfosterslaudativeoutjestedpassionalpassionalspassionarypassionedperfusingquaintestrelentingsetigeroussusurratedaruspicyexcernentexitiousexquisitiveexulcerativefrouncedlusoriousnidificatedpassionistpectousperspirativepreoccupyingquermoniousquirlentranced deliriousecstaticenrapturedsenselessministerialoppressoroverbearingmonumentalsuperiorvasttremendouslyfeateousthrongfultroutfulturribantjocundjovialistblithedapperhilariousjazzyliveliestlivelilyhumoristhumorsomejesterjocosemirthfulforeladyforelockforecarforelforeskirtforestersappellativenessaroideouscostivenessfleshlinesspleasuristwell naturedfaithfulgrappledstarvationfastingwantstarvingfulminationcrashthunder clapfat finished forthcomingon handpreparedripeyareamenablecarve upgearedpoisedset tostand bystandbyevanescedmuskedparedpreparedlyprecomposedproddfattygreasyoilyoleaginousbalmycreamypolishedsilkysleekslipperysmoothsmugunctuousadzeclozegreavelubricatedlubriciousmagilpoozingreflatetattingteemingunlubricatedwonkalmerychinkingchizzchizzingchucklingcringeddizzyinggabbinggagglinggallizegracklesgraklegreateninglievelievestlubralubraslubriclubricallubricateslucernmozingnabbingplackroystingsawderingslittingsmirkssnuzzlingstavingtashingtassellingtawingteeingtemulentavolatecudgelingglewgraining.grecizelubricitateshrapweezeligneousfeistyfractiousficklehoydenrompishvacillantbuxomchangingfitfulrestlesscrabbedhot temperedill naturedirascibledirefranticindignantinfernalirefulblazeflareflashflameletflemetrenchantfifthlysharpflat obtuseplanarcompressedflattenedlevelledflatten outflatlongflattensmatureveteranauthenticcompletecookeddefinitedefinitivedetermineddevoutfullgenuinehard boiledloyalmaturedorthorealreliablerightsincereweatheredpuckapukapicasflushgreenlatestmaidentenderunfadedverdancyverdantyoungfreshen upfreshetfreshlyfreshedfreshenedfreshensfreshesfreshishfresh newflawlesslyneatlyterselyclementlyindelibleconcupyiratemoodybrahmscelibatescelibatistcarewornconfuseddistractedperplexedsparkingtastyostentatiousflamboyantglitterytheatricalviewypretentiousfigureheadgrandiosekitschmodalexhibitionistexhibitionisticexhibitivegallopgallopadedgallopedgallopersserpetgallopingcrested swiftfast pacedhigh speedhigh velocityimpetuousnesspacerescalatorypacersplouteringexpedientialglideslideglissadeslippiddlingslinkslip upslippyslipstreamslitheringsliverysluicingsnortysquallingunfluctuatingfletchingplappingpulvinatepuppingslatterslatteringslattersslatteryslilyslingsslinkingslinkyslinterslippagesslipperierslippierslippinessslipslopslitterssloppingslubberslubberingslubbingsluicyslumpsslurpssnarysnirtlingspallingsquittersunflusheffluviateslepsliddingslippernessslockingsluingfluentlygriefdolourhypobelowbeneathdowninferiorlowerunderunderneathcatch fireimpressionablehuffykittleperceptivepercipientsensitivesentimentaltouchysensitisesensitisedsensitisingsensitizedsensitizingsusceptiblesensitivessusceptivesuscipientsensatedsensifacientsensiferoussensificsensificatoryirritablejokelaughjudicioussensiblerationalknavishknitwattlebecomegathergetpluckpretendselectshamstitchswankweavebecomingnessknishknitworkknitchesknittlelustlecherysexual desiremilkbrave manlionocherwringerlionslionhoodmindedmournbewaillamentwailyammerbemoanbemoanersbemoaningbemoaningsbemoilbewailingbewailingslamentingsmuchprolificwantlessabundantoverplentyneatpatesirtankaccentbeginningchiefcommencementcrowndroneheadnoteoriginpinnaclepolltoptuneheadedheadfulheads upheadspringheadwindsubheadtowheadvoweliseheadhuntheadsunheadvowelizedvowelizesvowelsheadpanmanheadvoweledperfectattachedsolemnisationfirmedmatlowmaturatedsolemnersolemnestsolemnisedsolemnisessolemnizedstaunchestaguiltpenetrativepurflenutrientnutritiousnutritivemuzzierhastilyperspicaciousquick sightedsharp sightednesssetacoeousstabthornyclavelplosive speech soundscowlsharp pointedpointedspicularneedlelikeslap dashwastefullywastefulnessblindingextravagantindiscriminateprecipitatelypromiscuousundiscriminatingindiscreteindiscriminatelyindraughtindraughtsincindentalindigitatedindigitatingindiscriminativeindiscussedindispersedindisposingindisputedindoctrinateddirectlysternausteretangdoor leafexcitementfluxat oncescreenseasoningshutterupsetupturnedpittpuitdumplingsquincevinegarychoughchoughsinviolatestraightfortifiedinconvertibleunambiguousabidingeducatedliteratetrainedacceleratoracatalecticaculeateerecthealthyvirileeffectiveinsightfulseerintentwillingempugnangerxianbrackishsalinesalsuginousbunkumclaptraphokumlevityperkinessvanitycoarsedourfell felongruffgrumsurlyloppingpoundingreapingwhippingdismembermentformshapeterraintractdemoniacviolentlyedgyeloquentfluentsharp tonguedvolubleepilepticexplosiveflamingfastedfastensobserve fastmausoleumfast dayfastifastnessesfastsnastythickheart piercinglaceratingloudmouthvoicefulloudishundismayedwing footed
Idioms related to the meaning of Taiz - تیز
What are the meanings of Taiz - تیز in English?
Meanings of the word Taiz - تیز in English are acid, acrid, active, acute, brisk, caustic, clever, cutting, fast, fervent, feisty, fierce, fiery, furious, glib, glibly, hot, impetuous, keen, lively, mordacious, piping, piquant, poignant, quick, rakish, rally, rapid, sharp, sharp pointed, shrill, smart, speedy, spicy, spunk, spry, strong, tart, tangy, tempestuous, tremendous, trenchant, vehement, vivid, violent, zippy, accelerated, aculeated, brainy, braky, brisant, brisk up, brisken, edgy, expeditious, fipple, furring, hectic, heft up, impounding, intense, intensified, larcenous, lasher, loud, nipping, ostensive, piercing, pungent, quicker, sharpened, sharpy, shirty, snappy, spadeful, spanker, spanking, speeding, spirant, spunky, swank, torrential, acuminated, agouty, brisked, briskened, briskening, brisker, briskest, brisking, eerier, expedited, expeditive, fady, fastish, fastuous, feaster, ferreous, fient, flattish, flintily, flisk, flisky, flong, flouncy, fluking, furfurous, furzy, glisk, hypural, larky, lusk, lustier, musaceous, pacey, palpated, panderly, panderous, pandurated, pandying, pisky, ploutered, pulverous, quaky, quiverish, ripplier, ripplingly, ripply, ruddying, sharked, sharny, sharped, sharpers, sharpish, smittle, spangler, spangling, spankingly, spankings, spathulate, spattee, spatular, spatule, speaning, sped, speeded, speedful, speedless, speered, speired, spewed, spewiness, spewy, spieling, spiking, spirated, spirewise, splent, splenting, spoliatory, spongious, sprighting, sprucing, spuddy, spurry, spurtle, steedy, steened, steered, streamy, strid, stridden, strode, strouting, surfeited, surgeful, swardy, upblowing, upping, yare, zappy, accoutering, blustrous, dashy, drasty, fascet, fastigiated, ferulaceous, impanated, incendious, incensive, infandous, lustering, piaculous, pulverulent, radious, riparious, sharp witted, sharpling, spatiate, speece, spirable, spriteful, spritely, thretty, wing footed, speeded up and keen witted. To understand how would you translate the word Taiz - تیز in English, you can take help from words closely related to Taiz - تیز or it’s English translations. Some of these words can also be considered Taiz - تیز synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Taiz - تیز. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Taiz - تیز in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Taiz - تیز in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Taiz - تیز with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by taiz?
Meanings of taiz are acid, acrid, active, acute, brisk, caustic, clever, cutting, fast, fervent, feisty, fierce, fiery, furious, glib, glibly, hot, impetuous, keen, lively, mordacious, piping, piquant, poignant, quick, rakish, rally, rapid, sharp, sharp pointed, shrill, smart, speedy, spicy, spunk, spry, strong, tart, tangy, tempestuous, tremendous, trenchant, vehement, vivid, violent, zippy, accelerated, aculeated, brainy, braky, brisant, brisk up, brisken, edgy, expeditious, fipple, furring, hectic, heft up, impounding, intense, intensified, larcenous, lasher, loud, nipping, ostensive, piercing, pungent, quicker, sharpened, sharpy, shirty, snappy, spadeful, spanker, spanking, speeding, spirant, spunky, swank, torrential, acuminated, agouty, brisked, briskened, briskening, brisker, briskest, brisking, eerier, expedited, expeditive, fady, fastish, fastuous, feaster, ferreous, fient, flattish, flintily, flisk, flisky, flong, flouncy, fluking, furfurous, furzy, glisk, hypural, larky, lusk, lustier, musaceous, pacey, palpated, panderly, panderous, pandurated, pandying, pisky, ploutered, pulverous, quaky, quiverish, ripplier, ripplingly, ripply, ruddying, sharked, sharny, sharped, sharpers, sharpish, smittle, spangler, spangling, spankingly, spankings, spathulate, spattee, spatular, spatule, speaning, sped, speeded, speedful, speedless, speered, speired, spewed, spewiness, spewy, spieling, spiking, spirated, spirewise, splent, splenting, spoliatory, spongious, sprighting, sprucing, spuddy, spurry, spurtle, steedy, steened, steered, streamy, strid, stridden, strode, strouting, surfeited, surgeful, swardy, upblowing, upping, yare, zappy, accoutering, blustrous, dashy, drasty, fascet, fastigiated, ferulaceous, impanated, incendious, incensive, infandous, lustering, piaculous, pulverulent, radious, riparious, sharp witted, sharpling, spatiate, speece, spirable, spriteful, spritely, thretty, wing footed, speeded up and keen witted
Whats the definition of taiz?
Definition of the taiz are
- street name for lysergic acid diethylamide
- any of various water-soluble compounds having a sour taste and capable of turning litmus red and reacting with a base to form a salt
- having the characteristics of an acid
- being sour to the taste
- strong and sharp
- the voice used to indicate that the grammatical subject of the verb is performing the action or causing the happening denoted by the verb
- chemical agent capable of activity
- taking part in an activity
- engaged in or ready for military or naval operations
- engaged in full-time work
- full of activity or engaged in continuous activity
- tending to become more severe or wider in scope
- disposed to take action or effectuate change
- (of e.g. volcanos) erupting or liable to erupt
- in operation
- a person who is a participating member of an organization
- (of e.g. volcanos) capable of erupting
- exerting influence or producing a change or effect
- (of the sun) characterized by an increased occurrence of sunspots and flares and radio emissions
- (used of verbs (e.g. to run') and participial adjectives (e.g. running' in running water')) expressing action rather than a state of being
- expressing that the subject of the sentence has the semantic function of actor:
- of an angle; less than 90 degrees
- having or experiencing a rapid onset and short but severe course
- of critical importance and consequence
- ending in a sharp point
- a mark placed above a vowel to indicate pronunciation
- extremely sharp or severe
- become brisk
- very active
- quick and energetic
- imparting vitality and energy
- any chemical substance that burns or destroys living tissue
- mentally quick and resourceful
- showing self-interest and shrewdness in dealing with others
- showing inventiveness and skill
- unpleasantly cold and damp
- the act of cutting something into parts
- the act of penetrating or opening open with a sharp edge
- the division of a deck of cards before dealing
- the act of diluting something
- a piece cut off from the main part of something
- a part (sometimes a root or leaf or bud) removed from a plant to propagate a new plant through rooting or grafting
- the activity of selecting the scenes to be shown and putting them together to create a film
- an excerpt cut from a newspaper or magazine
- (of speech) harsh or hurtful in tone or character
- removing parts from hard material to create a desired pattern or shape
- the act of shortening something by chopping off the ends
- painful as if caused by a sharp instrument
- unrestrained by convention or morality
- abstaining from food
- abstain from eating
- abstain from certain foods, as for religious or medical reasons
- resistant to destruction or fading
- (of surfaces) conducive to rapid speeds
- acting or moving or capable of acting or moving quickly
- at a rapid tempo
- (used of timepieces) indicating a time ahead of or later than the correct time
- securely fixed in place
- hurried and brief
- quickly or rapidly (often used as a combining form)
- unwavering in devotion to friend or vow or cause
- (of a photographic lens or emulsion) causing a shortening of exposure time
- firmly or closely
- (archaic) extremely hot, burning, or glowing
- showing courage
- quick to take offense
- marked by extreme and violent energy
- marked by extreme intensity of emotions or convictions; inclined to react violently; fervid
- ruthless in competition
- violently agitated and turbulent
- like or suggestive of fire
- marked by extreme and violent energy
- marked by extreme anger
- artfully persuasive in speech
- having only superficial plausibility
- marked by lack of intellectual depth
- with superficial plausibility
- producing a burning sensation on the taste nerves
- very fast; capable of quick response and great speed
- of a seeker; very near to the object sought
- marked by violent force
- characterized by undue haste and lack of thought or deliberation
- painful as if caused by a sharp instrument
- quick and energetic
- full of zest or vigor
- filled with events or activity
- full of life and energy
- elastic; rebounds readily
- full of spirit; full of life
- capable of wounding
- biting or given to biting
- a long tube made of metal or plastic that is used to carry water or oil or gas etc.
- playing a pipe or the bagpipes
- a thin strip of covered cord used to edge hems
- (used of heat) extremely
- engagingly stimulating or provocative
- attracting or delighting
- arousing affect
- keenly distressing to the mind or feelings
- moving quickly and lightly
- hurried and brief
- any area of the body that is highly sensitive to pain (as the flesh underneath the skin or a fingernail or toenail)
- apprehending and responding with speed and sensitivity
- easily aroused or excited
- accomplished rapidly and without delay
- with little or no delay
- marked by a carefree unconventionality or disreputableness
- marked by up-to-dateness in dress and manners
- harass with persistent criticism or carping
- call to arms; of military personnel
- gather or bring together
- the feat of mustering strength for a renewed effort
- (sports) an unbroken sequence of several successive strokes
- an automobile race run over public roads
- a large gathering of people intended to arouse enthusiasm
- a marked recovery of strength or spirits during an illness
- return to a former condition
- gather
- a part of a river where the current is very fast
- done or occurring in a brief period of time
- characterized by speed; moving with or capable of moving with high speed
- extremely steep
- ending in a sharp point
- a long thin sewing needle with a sharp point
- a musical notation indicating one half step higher than the note named
- harsh
- having or made by a thin edge or sharp point; suitable for cutting or piercing
- keenly and painfully felt; as if caused by a sharp edge or point
- quick and forceful
- very sudden and in great amount or degree
- marked by practical hardheaded intelligence
- (of something seen or heard) clearly defined
- changing suddenly in direction and degree
- having or emitting a high-pitched and sharp tone or tones
- (of a musical note) raised in pitch by one chromatic semitone
- having a sharp point
- utter a shrill cry
- of colors that are bright and gaudy
- being sharply insistent on being heard
- having or emitting a high-pitched and sharp tone or tones
- be the source of pain
- characterized by quickness and ease in learning
- elegant and stylish
- improperly forward or bold
- a kind of pain such as that caused by a wound or a burn or a sore
- showing mental alertness and calculation and resourcefulness
- capable of independent and apparently intelligent action
- quick and brisk
- painfully severe
- accomplished rapidly and without delay
- characterized by speed; moving with or capable of moving with high speed
- suggestive of sexual impropriety
- producing a burning sensation on the taste nerves
- the courage to carry on
- material for starting a fire
- moving quickly and lightly
- strong and sure
- not faint or feeble
- of verbs not having standard (or regular) inflection
- having strength or power greater than average or expected
- freshly made or left
- having a strong physiological or chemical effect
- having or wielding force or authority
- of good quality and condition; solidly built
- being distilled rather than fermented; having a high alcoholic content
- immune to attack; incapable of being tampered with
- harsh
- a small open pie with a fruit filling
- tasting sour like a lemon
- a pastry cup with a filling of fruit or custard and no top crust
- tasting sour like a lemon
- characterized by violent emotions or behavior
- extraordinarily large in size or extent or amount or power or degree
- extreme in degree or extent or amount or impact
- extraordinarily good or great; used especially as intensifiers
- clearly or sharply defined to the mind
- having keenness and forcefulness and penetration in thought, expression, or intellect
- characterized by or full of force and vigor
- marked by extreme intensity of emotions or convictions; inclined to react violently; fervid
- characterized by great force or energy
- evoking lifelike images within the mind
- having the clarity and freshness of immediate experience
- (of color) having the highest saturation
- having strong or striking color
- characterized by violence or bloodshed
- marked by extreme intensity of emotions or convictions; inclined to react violently; fervid
- (of colors or sounds) intensely vivid or loud
- effected by force or injury rather than natural causes
- acting with or marked by or resulting from great force or energy or emotional intensity
- quick and energetic
- marked by lively action
- speeded up, as of an academic course
- having or resembling a stinger or barb
- abounding with bracken
- covered with brambles and ferns and other undergrowth
- of or relating to the power (the shattering effect) of an explosive
- become brisk
- become brisk
- being in a tense state
- marked by speed and efficiency
- a wooden plug forming a flue pipe (as the mouthpiece of a recorder)
- strip used to give a level surface for attaching wallboard
- a furlike coating of matter as on the tongue
- marked by intense agitation or emotion
- lift or elevate
- placing private property in the custody of an officer of the law
- (of color) having the highest saturation
- possessing or displaying a distinctive feature to a heightened degree
- extremely sharp or severe
- made more intense
- having a disposition to steal
- a driver who urges the animals on with lashes of a whip
- with relatively high volume
- characterized by or producing sound of great volume or intensity
- (used chiefly as a direction or description in music) loud; with force
- capable of wounding
- pleasantly cold and invigorating
- represented or appearing as such; pretended
- manifestly demonstrative
- painful as if caused by a sharp instrument
- strong and sharp
- capable of wounding
- more quickly
- made sharp or sharper
- having the point made sharp
- an alert and energetic person
- a professional card player who makes a living by cheating at card games
- (British informal) ill-tempered or annoyed
- quick and energetic
- pleasantly cold and invigorating
- marked by up-to-dateness in dress and manners
- apt to speak irritably
- smart and fashionable
- a fore-and-aft sail set on the aftermost lower mast (usually the mizzenmast) of a vessel
- a hitter who slaps (usually another person) with an open hand
- quick and energetic
- the act of slapping on the buttocks
- changing location rapidly
- a continuant consonant produced by breath moving against a narrowing of the vocal tract
- of speech sounds produced by forcing air through a constricted passage (as f', s', z', or th' in both thin' and then')
- showing courage
- elegance by virtue of being fashionable
- imposingly fashionable and elegant
- pouring in abundance
- resembling a torrent in force and abundance
- relating to or resulting from the action of a torrent
- مُختَصَر اور تیز مَرض میں شِدَّت
- جیسے دِل کا دورہ یا اسقاط کی وجہ سے خُون کا جاری ہونا یا مِعدے کا اچانَک بَڑھاو
- بہت اُونچی اور پردے بھاڑ آواز
- مُقامی لیکن عموماً سطحی سے درد کا باعِث ہونا
- بعض دھاتوں کو پَگھلا کر صاف کر کے حاصِل کیا جاتا ھے
- شدید جِسمانی قُوَّت سے مُتعلِّق
What is the synonym of taiz?
Synonym of word taiz are کھٹائی, چوک, ترشی, تیزاب, تیز, تیزابی, حمذ, ترشہ, چرپرا, جھلی
What are the idioms related to taiz?
Here are the idioms that are related to the word taiz.
- Piping hot
- Bind fast find fast
- Is it necessary to add acid to the lemon
- Joy surfeited turns to sorrow
- Little griefs are loud great griefs are silent
How to use taiz in a sentence?
Here is few example on how to use taiz in a sentence.
- They disappeared quickly — وہ تیزی سے غائب ہو جاتے تھے
- It shrunk quickly — یہ تیزی سے چھوٹا پڑ گیا